Enhanced Validation

Polyclonal Anti-ACO2 Antibody

aconitase 2, mitochondrial
References (7)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ACO2
Alternative Gene Names
ACONM
Open Datasheet
Price
$505.00
Product Number
HPA001097
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human heart muscle and liver tissues using HPA001097 antibody. Corresponding ACO2 RNA-seq data are presented for the same tissues.
Show all images
[2 pictures]
Western blot analysis in human cell line HL-60.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
aconitase 2, mitochondrial
Target Gene
ACO2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEG
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000022477 (97%)

Rat ENSRNOG00000024128 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA001097 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA001097 on the Human Protein Atlas
Protein Name
aconitase 2, mitochondrial
Gene Name
ACO2
Alternative Gene Names
ACONM
UniProt ID
Q99798
Gene (Ensembl)
ENSG00000100412
Entrez Gene ID
Entrez gene: 50
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000100412 on the Human Protein Atlas

Mirhadi S, Zhang W, Pham NA, Karimzadeh F, Pintilie M, Tong J, Taylor P, Krieger J, Pitcher B, Sykes J, Wybenga-Groot L, Fladd C, Xu J, Wang T, Cabanero M, Li M, Weiss J, Sakashita S, Zaslaver O, Yu M, Caudy AA, St-Pierre J, Hawkins C, Kislinger T, Liu G, Shepherd FA, Tsao MS, Moran MF

Mitochondrial Aconitase ACO2 Links Iron Homeostasis with Tumorigenicity in Non–Small Cell Lung Cancer

Mol Cancer Res , 2022 Oct 10; 21(1):36-50. Epub 2022 Oct 10

PubMed ID: 36214668 DOI: 10.1158/1541-7786.MCR-22-0163

Medina-Carbonero M, Sanz-Alcázar A, Britti E, Delaspre F, Cabiscol E, Ros J, Tamarit J

Mice harboring the FXN I151F pathological point mutation present decreased frataxin levels, a Friedreich ataxia-like phenotype, and mitochondrial alterations

Cell Mol Life Sci , 2022 Jan 17; 79(2):74. Epub 2022 Jan 17

PubMed ID: 35038030 DOI: 10.1007/s00018-021-04100-5

Stumpf SK, Berghoff SA, Trevisiol A, Spieth L, Düking T, Schneider LV, Schlaphoff L, Dreha-Kulaczewski S, Bley A, Burfeind D, Kusch K, Mitkovski M, Ruhwedel T, Guder P, Röhse H, Denecke J, Gärtner J, Möbius W, Nave KA, Saher G

Ketogenic diet ameliorates axonal defects and promotes myelination in Pelizaeus–Merzbacher disease

Acta Neuropathol , 2019 Mar 27; 138(1):147-161. Epub 2019 Mar 27

PubMed ID: 30919030 DOI: 10.1007/s00401-019-01985-2

Latonen L, Afyounian E, Jylhä A, Nättinen J, Aapola U, Annala M, Kivinummi KK, Tammela TT, Beuerman RW, Uusitalo H, Nykter M, Visakorpi T

Integrative proteomics in prostate cancer uncovers robustness against genomic and transcriptomic aberrations during disease progression

Nat Commun , 2018 Mar 21; 9:1176. Epub 2018 Mar 21

PubMed ID: 29563510 DOI: 10.1038/s41467-018-03573-6

Ilgen P, Stoldt S, Conradi LC, Wurm CA, Rüschoff J, Ghadimi BM, Liersch T, Jakobs S

STED Super-Resolution Microscopy of Clinical Paraffin-Embedded Human Rectal Cancer Tissue

PLoS One , 2014; 9(7):e101563. Epub 2014 Jul 15

PubMed ID: 25025184 DOI: 10.1371/journal.pone.0101563

Cantu D, Fulton RE, Drechsel DA, Patel M

Mitochondrial aconitase knockdown attenuates paraquat-induced dopaminergic cell death via decreased cellular metabolism and release of iron and H₂O₂.

J Neurochem , 2011 Jul; 118(1):79-92. Epub 2011 May 19

PubMed ID: 21517855 DOI: 10.1111/j.1471-4159.2011.07290.x

Did we miss your publication?

Have you published using HPA001097? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen ACO2 (APrEST73402)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch