Enhanced Validation

Anti-WWTR1 Antibody

WW domain containing transcription regulator 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human WWTR1
Alternative Gene Names
DKFZp586I1419, TAZ
Price
$437.00
Product Number
AMAb90730
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
WW domain containing transcription regulator 1
Target gene
WWTR1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Epitope
Binds to an epitope located within the peptide sequence SSWRKKILPESFFKE as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016617 (96%)

Mouse ENSMUSG00000027803 (96%)

Clonality
Monoclonal
Clone ID
CL0371
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
WW domain containing transcription regulator 1
Gene Name
WWTR1
Alternative Gene Names
DKFZp586I1419, TAZ
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature.
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Did we miss your publication?

Have you published using AMAb90730? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch