• Fast Shipping to 120+ Countries
Cart 0

 

Antibody Technologies FAQs

Find answers to the most commonly asked questions
regarding our antibodies, applications, and protocols. 

 

 

Questions on Primary Antibodies

  • Which primary antibodies do you offer?

    We are the manufacturer and supplier of two brands of primary antibodies, Triple A Polyclonals and PrecisA Monoclonals.

    PrecisA Monoclonals™ are mouse monoclonal antibodies. The development of the PrecisA Monoclonals is based on the knowledge from the Human Protein Atlas with careful antigen design and extended validation of antibody performance. In addition, each PrecisA Monoclonal is epitope mapped and provided with the most relevant characterization data for its specific target.

    Triple A Polyclonals™ are advanced research-grade rabbit polyclonals, developed initially as part of the Human Protein Atlas project to create a protein expression map of the complete human proteome. You can find over 21,000 Triple A Polyclonals in our catalog, validated for IHC, ICC, and Western blot.

  • What are PrecisA Monoclonals?

    We are the manufacturer and supplier of PrecisA Monoclonals™: precise, accurate, and targeted mouse monoclonals.

    PrecisA Monoclonals™ are in-house developed mouse monoclonal antibodies for dedicated targets. The antibodies are validated for use in IHC, WB, and ICC-IF.

    PrecisA Monoclonals are cultured in murine cell lines. At Atlas Antibodies we take special care in designing clones that recognize unique non-overlapping epitopes and/or isotypes. As a result, PrecisA Monoclonals offer premium performance in the approved applications.

    Using our stringent production process and characterization procedures, PrecisA Monoclonals ensure specificity, multiplexing opportunities, secured continuity, and a stable supply.

  • What are Triple A Polyclonals?

    We are the manufacturer and supplier of Triple A Polyclonals™ (Atlas Antibodies Advanced Polyclonals).

    Triple A Polyclonals™ are research-grade rabbit polyclonals developed within the Human Protein Atlas project. Triple A Polyclonals are specific, reproducible, and versatile. 

    Unique Features of Triple A Polyclonals:

    • 22,000 rabbit polyclonal antibodies
    • Covers 75% of the human proteome
    • Validated for IHC, WB, ICC-IF
    • 500 IHC images for each antibody on the Human Protein Atlas.
    • Several epitopes for high sensitivity.
    • Unique antigen design for optimal specificity.
    • Ensured lot-to-lot reproducibility.
    • Enhanced Validation as an added layer of security.

Immunohistochemistry (IHC)

  • Where can I find your IHC Protocol?

    We recommend the following protocols for using our antibodies in IHC:

    IHC Standard Protocol
    IHC Protocol - Ventana Discovery XT
    IHC Protocol - IF Detection
    IHC-IF Protocol - Multiplex

    You can find all our protocols here

  • How do you validate your antibodies in IHC?

    All IHC images are annotated manually by skilled professionals. Based on the staining pattern alone, the first step is performed without consulting any literature to achieve an unbiased annotation of each antibody.

    Next, another team of researchers compares the IHC staining results for each antibody with the available literature. The staining result of each antibody is also compared to RNA sequencing data from 50 different human tissues and the results using other antibodies against the same target, when available.

    As an additional validation layer, enhanced validation is performed in IHC using orthogonal methods and validation by independent antibodies. Learn more about our validation here and the different enhanced validation methods here.

  • Where can I see the result from the IHC stainings?

    You can find a selection of IHC staining images on each product's page. In addition, as a reference, you can also access a variety of high-resolution IHC images from normal and cancerous human tissues on the Human Protein Atlas (HPA) portal.

    To find this information, follow the link under “Additional Images” on the antibody product page you are interested in. The IHC images from normal human tissues are displayed in the "Tissue" section. The IHC images from cancerous tissues are displayed in the "Pathology" section.  

Western Blot (WB)

  • Where can I find your Western blot protocol?

    Here is the standard protocol we recommend for Western blot using our products. 

    If your antibody requires BSA blocking, please use this alternative Western blot protocol using BSA blocking instead.

    You can find all our protocols here

  • Have your antibodies been analyzed using Western Blot?

    Over 8,000 of our antibodies are approved for Western blot. The antibodies are analyzed on endogenous human cell lines, tissue protein lysates, or recombinant full-length human protein lysates. As an additional validation layer, enhanced validation is performed in WB using orthogonal, genetic, and recombinant expression methods.

    Learn more about how our antibodies are validated in Western blot here.

  • Why does the actual Western blot band sometimes differ in size compared to predicted size?

    There are several reasons why an actual Western blot (WB) band size may differ from a predicted size. Such reasons include the following: 

    • Splice variants: one gene can generate proteins of different sizes due to alternative splicing.  
    • Post-translational modifications like glycosylations and phosphorylations increase the molecular weight of the target proteins.   
    • Post-translational cleavage to generate the active form of pro-proteins results in a molecular weight change, e.g., proinsulin and insulin.
    • Dimers and multimers can be present even though the sample run under reducing conditions.
    • Hydrophobic proteins, such as transmembrane proteins, may have difficulties migrating through the gel resulting in different multi-band patterns. 

Immunofluorescence Cytochemistry (ICC-IF)

  • Is the X antibody recommended for Immunofluorescence in cell lines?

    Over 11,000 of our antibodies are recommended for immunofluorescence in cell lines (ICC-IF). Each antibody's product page contains information on all the applications the antibody is validated for and species homology.

    In addition, for all the TripleA Polyclonals validated in ICC-IF,  you can select more images by clicking the link to the "Cell Line" section in the Human Protein Atlas database showing additional images (ICC-IF characterization data) from 1055 human cell lines, including 985 cancer cell lines. 

    In the Cell Line section, it is possible to choose how to visualize the ICC-IF images from the selected cell lines with one or several reference markers by switching on/off the following channels: green (for the antibody staining), blue (for the nucleus); red (for the microtubules), and yellow (for the endoplasmic reticulum, ER).

  • Are your antibodies tested in ELISA?

    Our antibodies are tested to recognize their antigen (recombinant protein) in ELISA. However, ELISA is currently not one of our validated applications. If you are interested in testing one of our antibodies in ELISA, you are welcome to join our Explorer Program

The Human Protein Atlas (HPA)

  • What is the Human Protein Atlas?

    The Human Protein Atlas is a Swedish academic project and a unique world-leading effort to map all the human proteins in cells, tissues, and organs in the human body using antibody-based imaging, mass spectrometry-based proteomics, transcriptomics, and systems biology. 

    The Human Protein Atlas database offers a map of human protein expression You can search for specific genes/proteins or explore the 12 different sections.

    The project is a valuable tool for researchers and students. 

    The antibodies developed within the project are manufactured and distributed by Atlas Antibodies under the brand name Triple A Polyclonals. All the characterization data for each antibody is freely accessible online.

  • What are the 12 sections on the Human Protein Atlas website about?

    The Human Protein Atlas consists of twelve separate sections, each focusing on a particular aspect of the genome-wide analysis of human proteins:

    • The Tissue section shows the distribution of the proteins across all major tissues and organs in the human body.
    • The Brain section explores the distribution of proteins in various regions of the mammalian brain.
    • The Single Cell Type section shows the expression of protein-coding genes in single human cell types based on scRNA-seq.
    • The Tissue Cell Type section shows the expression of protein-coding genes in human cell types based on bulk RNAseq data.
    • The Pathology section shows the impact of protein levels on the survival of patients with cancer.
    • The Disease Blood Atlas section shows protein levels in blood in patients with different diseases and protein panels used for disease prediction.
    • The Immune Cell section shows the expression of protein-coding genes in immune cell types.
    • The Blood Protein section describes proteins detected in blood and proteins secreted by human tissues.
    • The Subcellular section shows the subcellular localization of proteins in single cells.
    • The Cell Line section shows the expression of protein-coding genes in human cell lines.
    • The Structure section shows experimental and predicted 3D structures of proteins including antigen sites and population- and clinical variants.
    • The Metabolic section explores the expression of protein-coding genes in the context of the human metabolic network.
  • What is the relationship between Atlas Antibodies and the Human Protein Atlas?

    Atlas Antibodies and the Human Protein Atlas share a collaborative relationship aimed at advancing the understanding of the human proteome.

    Atlas Antibodies specializes in producing rigorously validated antibodies, which are crucial tools for protein detection such as Triple A Polyclonals and PrecisA Monoclonals.

    These antibodies are utilized within the Human Protein Atlas project to immunostain tissues and cells, enabling the comprehensive mapping of protein expression across various biological samples. Through this partnership, Atlas Antibodies and the Human Protein Atlas contribute to the ambitious goal of cataloging all human proteins, furthering research in biology and medicine.

  • How does the partnership between Atlas Antibodies and the Human Protein Atlas contribute to biomedical research?

    The collaboration between Atlas Antibodies and the Human Protein Atlas significantly advances biomedical research by providing high-quality tools for protein analysis. Atlas Antibodies' expertise in antibody production ensures the availability of reliable reagents for detecting protein expression.

    By incorporating these antibodies into the Human Protein Atlas project, researchers gain access to a comprehensive resource for studying the localization and abundance of human proteins in various tissues and cells. This partnership accelerates discoveries in fields such as cancer biology, neuroscience, and drug development, ultimately enhancing our understanding of human biology and disease mechanisms.

Antibody Validation

  • How do you develop and validate your antibodies?

    Triple A Polyclonals and PrecisA Monoclonals are carefully designed using a proprietary antigen design software that selects a Protein Epitope Signature Tag (PrEST) sequence of between 50 to 150 amino acids having the lowest possible identity to other human proteins. The PrEST concept secures the highest level of specificity when used for antibody production. 

    Triple A Polyclonals are derived from rabbits, and PrecisA Monoclonals from mice.

    The antibodies are developed against human protein fragments and are validated against human tissues and cells. A selection of the antibodies is also validated in rodent samples. The antibodies pass through a series of validation steps, including specific target recognition on protein array (or ELISA), and testing using IHC, WB, and ICC-IF. Achieved results are compared to literature, to RNA sequencing information, and to the results by other antibodies against the same target, when available.

    A description of our validation process in the different applications is available on the Antibody Validation page. In addition to standard validation, enhanced validation is performed using five validation methods: genetic validation, orthogonal validation, validation by independent antibodies, recombinant expression validation, and migration capture MS validation.

  • Which applications are the antibodies validated for?

    Our antibodies are validated for one or more applications, such as IHC, WB, and ICC. All the information about the applications for which an antibody has been validated is available on the antibody product page.

    If you are interested in testing our antibodies in an application or species not yet recommended for a specific antibody, you are welcome to join our Explorer Program. In this program, we offer a 50% discount on the next vial you purchase or, alternatively, a 50% refund as soon as you share your results with us. 

  • Do the antibodies work in mouse or rat?

    Many of our antibodies recognize the corresponding mouse and rat proteins as well. This information is reported on each antibody’s product page. In addition, information about antigen sequence identity to mouse and rat orthologs is reported on the product datasheets for all antibodies. 

    If you are interested in testing our antibodies in a species or application not yet recommended for a specific antibody, you are welcome to join our Explorer Program. In this program, we offer a 50% discount on the next vial you purchase or, alternatively, a 50% refund as soon as you share your results with us.

PrEST Antigens

  • What are PrEST Antigens?

    PrEST Antigens are the immunogens used to generate Triple A Polyclonals and PrecisA Monoclonals. The PrEST Antigens are useful as control antigens, for example, as blocking agents and positive assay controls together with the corresponding antibody.

    They are recombinant human Protein Epitope Signature Tags (PrESTs) of approximately 50 to 150 amino acids expressed as fusion proteins with a dual tag consisting of His6 and Albumin Binding Protein (ABP). The protein-specific PrEST sequences are specified on the product pages for all antibodies.

  • How are the PrEST Antigens designed?

    The PrEST Antigens are designed to have a sequence identity as low as possible to other human proteins. The selection of PrESTs is based on a sliding window algorithm to predict the local and regional sequence identity of the various parts of a particular human protein to all the other protein sequences of the human proteome. Signal peptides and membrane regions are avoided using multiple software, including Phobius, SPOCTOPUS, and SignalP.

  • What is a His6ABP tag?

    The dual tag consists of a hexahistidyl (His6) tag in frame with an immunopotentiating Albumin Binding Protein (ABP)-tag. The His6 tag can be used for IMAC purification, and proteins fused to ABP, originating from the albumin binding region of Streptococcal Protein G, can be purified by Human Serum Albumin (HSA) affinity chromatography.

    The sequence of the dual tag is: GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA

    The specific human protein sequence begins directly after “VDKLAAA”. 

  • How are the PrEST Antigens produced?

    For cloning of the PrESTs, a pool of RNA consisting of material from several human tissues is used in an RT-PCR approach. The amplified gene fragments are cloned into the expression vector pAff8c using solid-phase cloning with biotinylated primers and magnetic beads, and all clones are sequences-verified. An E. coli (Rosetta) recombinant protein expression system is used for expressing the clones.

General Questions

  • Has product X been tested in species or applications not listed on the product page? 

    The product page specifies which applications and species each antibody is currently validated for. If the species or the application you are interested in is not listed, please get in touch with our Scientific Support. 

    If you are interested in testing one of our antibodies in a currently unsupported species or application, you are welcome to join our Explorer Program.

  • How are the antibodies purified?

    Triple A Polyclonals are produced using a standardized production process to ensure consistency. Only target-specific antibodies are collected by a unique three-step antibody purification process, using the recombinant PrEST-antigen as the affinity ligand.

    PrecisA Monoclonals are protein A purified.

  • Does the antibody detect the X isoform of the Y protein?

    The design of our antibodies is based on the information stated in the ENSEMBL database. On the product page of each antibody, there is a link to the corresponding antibody page on the Human Protein Atlas portal.

    There you can find the antigen sequence's identity to match protein-coding ENSEMBL gene transcripts. In addition, at the bottom of the page, there is a feature named "Antigen View". This graphical view allows you to study the position of the antigen sequence on the target protein compared to matching transcripts or isoforms. The antigen sequence is visualized as a horizontal green bar. Of course, you are always welcome to contact our Scientific Support if you need help.

  • Do you have any references for the X product?

    We are proud to have an increasing number of products referenced in articles published in high-impact journals. Our products are used worldwide and referenced in 1000s of scientific peer-reviewed papers.

    The references for our products are regularly updated on the product page of each product. In addition, we share some publications here.

    If you have used one of our products in one of your publications, please contact us.

  • Can I order a small test sample?

    We do not provide small test samples at this time, but each antibody is available in 25- and 100-microliter sizes.

    We have a Guarantee Program offering a free vial or your money back if the antibody does not perform as expected in validated applications when used following our protocol.

    We also provide an Explorer Program for testing antibodies in not yet validated applications or species.

    In addition, all our IHC-recommended antibodies are extensively characterized on the Human Protein Atlas website. Therefore, the staining patterns achieved using the antibodies in most human tissues can be carefully investigated before purchase.