Enhanced Validation

Polyclonal Anti-TMEM119 Antibody

transmembrane protein 119
References (21)
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human TMEM119
Open Datasheet
Price
$459.00
Product Number
HPA051870
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemical staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody HPA051870 (A) shows similar protein distribution across tissues to independent antibody HPA052650 (B).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
transmembrane protein 119
Target Gene
TMEM119
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000054675 (52%)

Rat ENSRNOG00000000700 (46%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-TMEM119 HPA052650.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA051870 on the Human Protein Atlas
Protein Name
transmembrane protein 119
Gene Name
TMEM119
UniProt ID
Q4V9L6
Gene (Ensembl)
ENSG00000183160
Entrez Gene ID
Entrez gene: 338773
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000183160 on the Human Protein Atlas

Taddei RN, Sanchez-Mico MV, Bonnar O, Connors T, Gaona A, Denbow D, Frosch MP, Gómez-Isla T

Changes in glial cell phenotypes precede overt neurofibrillary tangle formation, correlate with markers of cortical cell damage, and predict cognitive status of individuals at Braak III-IV stages

Acta Neuropathol Commun , 2022 May 9; 10:72. Epub 2022 May 9

PubMed ID: 35534858 DOI: 10.1186/s40478-022-01370-3

Uff CE, Patel K, Yeung C, Yip PK

Advances in Visualizing Microglial Cells in Human Central Nervous System Tissue

Biomolecules , 2022 Apr 19; 12(5):603. Epub 2022 Apr 19

PubMed ID: 35625531 DOI: 10.3390/biom12050603

Nutma E, Gebro E, Marzin MC, van der Valk P, Matthews PM, Owen DR, Amor S

Activated microglia do not increase 18 kDa translocator protein (TSPO) expression in the multiple sclerosis brain

Glia , 2021 Jun 19; 69(10):2447-2458. Epub 2021 Jun 19

PubMed ID: 34145928 DOI: 10.1002/glia.24052

van Olst L, Rodriguez-Mogeda C, Picon C, Kiljan S, James RE, Kamermans A, van der Pol SM, Knoop L, Michailidou I, Drost E, Franssen M, Schenk GJ, Geurts JJ, Amor S, Mazarakis ND, van Horssen J, de Vries HE, Reynolds R, Witte ME

Meningeal inflammation in multiple sclerosis induces phenotypic changes in cortical microglia that differentially associate with neurodegeneration

Acta Neuropathol , 2021 Mar 29; 141(6):881-899. Epub 2021 Mar 29

PubMed ID: 33779783 DOI: 10.1007/s00401-021-02293-4

Snijders GJ, van Zuiden W, Sneeboer MA, Berdenis van Berlekom A, van der Geest AT, Schnieder T, MacIntyre DJ, Hol EM, Kahn RS, de Witte LD

A loss of mature microglial markers without immune activation in schizophrenia

Glia , 2021 Jan 7; 69(5):1251-1267. Epub 2021 Jan 7

PubMed ID: 33410555 DOI: 10.1002/glia.23962

Hayashida S, Masaki K, Suzuki SO, Yamasaki R, Watanabe M, Koyama S, Isobe N, Matsushita T, Takahashi K, Tabira T, Iwaki T, Kira J

Distinct microglial and macrophage distribution patterns in the concentric and lamellar lesions in Baló's disease and neuromyelitis optica spectrum disorders

Brain Pathol , 2020 Sep 23; 30(6):1144-1157. Epub 2020 Sep 23

PubMed ID: 32902014 DOI: 10.1111/bpa.12898

Korotkov A, Puhakka N, Gupta SD, Vuokila N, Broekaart DW, Anink JJ, Heiskanen M, Karttunen J, van Scheppingen J, Huitinga I, Mills JD, van Vliet EA, Pitkänen A, Aronica E

Increased expression of miR142 and miR155 in glial and immune cells after traumatic brain injury may contribute to neuroinflammation via astrocyte activation

Brain Pathol , 2020 Jun 26; 30(5):897-912. Epub 2020 Jun 26

PubMed ID: 32460356 DOI: 10.1111/bpa.12865

Dumas AA, Pomella N, Rosser G, Guglielmi L, Vinel C, Millner TO, Rees J, Aley N, Sheer D, Wei J, Marisetty A, Heimberger AB, Bowman RL, Brandner S, Joyce JA, Marino S

Microglia promote glioblastoma via mTOR‐mediated immunosuppression of the tumour microenvironment

EMBO J , 2020 Jun 22; 39(15):e103790. Epub 2020 Jun 22

PubMed ID: 32567735 DOI: 10.15252/embj.2019103790

van Wageningen TA, Vlaar E, Kooij G, Jongenelen CA, Geurts JJ, van Dam AM

Regulation of microglial TMEM119 and P2RY12 immunoreactivity in multiple sclerosis white and grey matter lesions is dependent on their inflammatory environment

Acta Neuropathol Commun , 2019 Dec 11; 7:206. Epub 2019 Dec 11

PubMed ID: 31829283 DOI: 10.1186/s40478-019-0850-z

Satoh JI, Kino Y, Yanaizu M, Ishida T, Saito Y

Microglia express TMEM119 in the brains of Nasu-Hakola disease

Intractable Rare Dis Res , 2019 Nov; 8(4):260-265

PubMed ID: 31890453 DOI: 10.5582/irdr.2019.01123

Nutma E, Stephenson JA, Gorter RP, de Bruin J, Boucherie DM, Donat CK, Breur M, van der Valk P, Matthews PM, Owen DR, Amor S

A quantitative neuropathological assessment of translocator protein expression in multiple sclerosis

Brain , 2019 Oct 3; 142(11):3440-3455. Epub 2019 Oct 3

PubMed ID: 31578541 DOI: 10.1093/brain/awz287

Ramaglia V, Sheikh-Mohamed S, Legg K, Park C, Rojas OL, Zandee S, Fu F, Ornatsky O, Swanson EC, Pitt D, Prat A, McKee TD, Gommerman JL

Multiplexed imaging of immune cells in staged multiple sclerosis lesions by mass cytometry

eLife , 2019 Aug 1; 8:e48051. Epub 2019 Aug 1

PubMed ID: 31368890 DOI: 10.7554/eLife.48051

Bergner CG, van der Meer F, Winkler A, Wrzos C, Türkmen M, Valizada E, Fitzner D, Hametner S, Hartmann C, Pfeifenbring S, Stoltenburg‐Didinger G, Brück W, Nessler S, Stadelmann C

Microglia damage precedes major myelin breakdown in X‐linked adrenoleukodystrophy and metachromatic leukodystrophy

Glia , 2019 Feb 11; 67(6):1196-1209. Epub 2019 Feb 11

PubMed ID: 30980503 DOI: 10.1002/glia.23598

Hammond TR, Dufort C, Dissing-Olesen L, Giera S, Young A, Wysoker A, Walker AJ, Gergits F, Segel M, Nemesh J, Marsh SE, Saunders A, Macosko E, Ginhoux F, Chen J, Franklin RJ, Piao X, McCarroll SA, Stevens B

Single cell RNA sequencing of microglia throughout the mouse lifespan and in the injured brain reveals complex cell-state changes

Immunity , 2018 Nov 21; 50(1):253-271.e6. Epub 2018 Nov 21

PubMed ID: 30471926 DOI: 10.1016/j.immuni.2018.11.004

Zhang CJ, Jiang M, Zhou H, Liu W, Wang C, Kang Z, Han B, Zhang Q, Chen X, Xiao J, Fisher A, Kaiser WJ, Murayama MA, Iwakura Y, Gao J, Carman J, Dongre A, Dubyak G, Abbott DW, Shi FD, Ransohoff RM, Li X

TLR-stimulated IRAKM activates caspase-8 inflammasome in microglia and promotes neuroinflammation

J Clin Invest , 2018 Oct 29; 128(12):5399-5412. Epub 2018 Oct 29

PubMed ID: 30372424 DOI: 10.1172/JCI121901

Zheng P, Wang W, Ji M, Zhu Q, Feng Y, Zhou F, He Q

TMEM119 silencing inhibits cell viability and causes the apoptosis of gastric cancer SGC-7901 cells

Oncol Lett , 2018 Mar 28; 15(6):8281-8286. Epub 2018 Mar 28

PubMed ID: 30112075 DOI: 10.3892/ol.2018.8358

Zrzavy T, Machado‐Santos J, Christine S, Baumgartner C, Weiner HL, Butovsky O, Lassmann H

Dominant role of microglial and macrophage innate immune responses in human ischemic infarcts

Brain Pathol , 2017 Dec 28; 28(6):791-805. Epub 2017 Dec 28

PubMed ID: 29222823 DOI: 10.1111/bpa.12583

Krasemann S, Madore C, Cialic R, Baufeld C, Calcagno N, El Fatimy R, Beckers L, O’Loughlin E, Xu Y, Fanek Z, Greco DJ, Smith ST, Tweet G, Humulock Z, Zrzavy T, Conde-Sanroman P, Gacias M, Weng Z, Chen H, Tjon E, Mazaheri F, Hartmann K, Madi A, Ulrich J, Glatzel M, Worthmann A, Heeren J, Budnik B, Lemere C, Ikezu T, Heppner FL, Litvak V, Holtzman DM, Lassmann H, Weiner HL, Ochando J, Haass C, Butovsky O

The TREM2-APOE pathway drives the transcriptional phenotype of dysfunctional microglia in neurodegenerative diseases

Immunity , 2017 Sep 19; 47(3):566-581.e9

PubMed ID: 28930663 DOI: 10.1016/j.immuni.2017.08.008

Thais F Galatro, Inge R Holtman, Antonio M Lerario, Ilia D Vainchtein, Nieske Brouwer, Paula R Sola, Mariana M Veras, Tulio F Pereira, Renata E P Leite, Thomas Möller, Paul D Wes, Mari C Sogayar, Jon D Laman, Wilfred den Dunnen, Carlos A Pasqualucci, Sueli M Oba-Shinjo, Erik W G M Boddeke, Suely K N Marie, Bart J L Eggen

Transcriptomic analysis of purified human cortical microglia reveals age-associated changes

Nature Neuroscience , July 03, 2017

PubMed ID: None DOI: 10.1038/nn.4597

Zrzavy T, Hametner S, Wimmer I, Butovsky O, Weiner HL, Lassmann H

Loss of ‘homeostatic’ microglia and patterns of their activation in active multiple sclerosis

Brain , 2017 May 24; 140(7):1900-1913. Epub 2017 May 24

PubMed ID: 28541408 DOI: 10.1093/brain/awx113

Did we miss your publication?

Have you published using HPA051870? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-TMEM119 (AMAb91528)
Anti-TMEM119 (HPA052650)
Corresponding Antigens
PrEST Antigen TMEM119 (APrEST85802)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch