ANXA1-antibody-AMAb90558
ANXA1-antibody-AMAb90558
Anti-ANXA1
-
Immunohistochemical staining of human bronchus shows distinct positivity in ciliated epithelial cells.
-
Immunohistochemical staining of human lung shows nuclear positivity in a subset of pneumocytes and lymphoid cells.
-
Immunohistochemical staining of human bone marrow shows strong nuclear immunoreactivity in a subset of lymphoid cells.
-
Immunohistochemical staining of human fallopian tube shows strong positivity in the glandular cells.
-
Immunohistochemical staining of human placenta shows strong immunoreactivity in the trophoblast cells.
-
Dilution: 1:500 - 1:1000
-
Retrieval method: HIER pH6
-
Dilution: 1:500 - 1:1000
TTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKP
AFFAEKLHQAMKGVGTRHKALIRIMV
We are an experienced team of researchers dedicated to helping you with any questions you have regarding our products and their applications.
100 researchers are working within the Human Protein Atlas project. Our Scientific Support Team provides you with answers or guide you to the right people
If you have questions or comments regarding this antibody please contact our Scientific Support: contact@atlasantibodies.com.
Are you using our antibodies in an application or in a species we have not yet validated? Go to our Technical Support and Resources page and read about our Explorer Program.
Related Questions
We have not received any questions yet for this product








