Anti-ZBTB16 Antibody

zinc finger and BTB domain containing 16
Recommended Applications
Product Description
Polyclonal Antibody against Human ZBTB16
Alternative Gene Names
PLZF, ZNF145
Price
$450.00
Product Number
HPA001499
Unit Size
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
zinc finger and BTB domain containing 16
Target Gene
ZBTB16
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000066687 (98%)

Rat ENSRNOG00000029980 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
zinc finger and BTB domain containing 16
Gene Name
ZBTB16
Alternative Gene Names
PLZF, ZNF145
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000109906 on the Human Protein Atlas

Del Vento F, Vermeulen M, Ucakar B, Poels J, des Rieux A, Wyns C

Significant Benefits of Nanoparticles Containing a Necrosis Inhibitor on Mice Testicular Tissue Autografts Outcomes

Int J Mol Sci , 2019 Nov 20; 20(23):5833. Epub 2019 Nov 20

PubMed ID: 31757040 DOI: 10.3390/ijms20235833

Gassei K, Sheng Y, Fayomi A, Mital P, Sukhwani M, Lin CC, Peters KA, Althouse A, Valli H, Orwig KE

DDX4-EGFP transgenic rat model for the study of germline development and spermatogenesis

Biol Reprod , 2017 Feb 20; 96(3):707-719. Epub 2017 Feb 20

PubMed ID: 28339678 DOI: 10.1095/biolreprod.116.142828

Nakata H, Wakayama T, Takai Y, Iseki S

Quantitative Analysis of the Cellular Composition in Seminiferous Tubules in Normal and Genetically Modified Infertile Mice

J Histochem Cytochem , 2015/02/01; 63(2):99-113. Epub 2014 Nov 19

PubMed ID: 25411188 DOI: 10.1369/0022155414562045

Wasim M, Carlet M, Mansha M, Greil R, Ploner C, Trockenbacher A, Rainer J, Kofler R

PLZF/ZBTB16, a glucocorticoid response gene in acute lymphoblastic leukemia, interferes with glucocorticoid-induced apoptosis

J Steroid Biochem Mol Biol , 2010 Jun; 120(4-5):218-227

PubMed ID: 20435142 DOI: 10.1016/j.jsbmb.2010.04.019

Did we miss your publication?

Have you published using HPA001499? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch