Enhanced Validation

Anti-TSPAN7 Antibody

tetraspanin 7
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human TSPAN7
Alternative Gene Names
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
Price
$445.00
Product Number
HPA003140
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
tetraspanin 7
Target Gene
TSPAN7
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000003229 (96%)

Mouse ENSMUSG00000058254 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
tetraspanin 7
Gene Name
TSPAN7
Alternative Gene Names
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000156298 on the Human Protein Atlas

Wuttig D, Zastrow S, Füssel S, Toma MI, Meinhardt M, Kalman K, Junker K, Sanjmyatav J, Boll K, Hackermüller J, Rolle A, Grimm MO, Wirth MP

CD31, EDNRB and TSPAN7 are promising prognostic markers in clear-cell renal cell carcinoma revealed by genome-wide expression analyses of primary tumors and metastases.

Int J Cancer , 2012 Sep 1; 131(5):E693-704. Epub 2012 Feb 28

PubMed ID: 22213152 DOI: 10.1002/ijc.27419

Lindskog C, Asplund A, Engkvist M, Uhlen M, Korsgren O, Ponten F

Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets.

Discov Med , 2010 Jun; 9(49):565-78

PubMed ID: 20587347

Pontén F, Jirström K, Uhlen M

The Human Protein Atlas--a tool for pathology.

J Pathol , 2008 Dec; 216(4):387-93

PubMed ID: 18853439 DOI: 10.1002/path.2440

Did we miss your publication?

Have you published using HPA003140? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch