Anti-TCOF1 Antibody

Treacher Collins-Franceschetti syndrome 1
Recommended Applications
Product Description
Polyclonal Antibody against Human TCOF1
Alternative Gene Names
TCS, treacle
Price
$437.00
Product Number
HPA038237
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
Treacher Collins-Franceschetti syndrome 1
Target gene
TCOF1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTAS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000026108 (52%)

Mouse ENSMUSG00000024613 (44%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
Treacher Collins-Franceschetti syndrome 1
Gene Name
TCOF1
Alternative Gene Names
TCS, treacle
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000070814 on the Human Protein Atlas

Lambert JP, Picaud S, Fujisawa T, Hou H, Savitsky P, Uusküla-Reimand L, Gupta GD, Abdouni H, Lin ZY, Tucholska M, Knight JD, Gonzalez-Badillo B, St-Denis N, Newman JA, Stucki M, Pelletier L, Bandeira N, Wilson MD, Filippakopoulos P, Gingras AC

Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains

Mol Cell , 2019 Feb 7; 73(3):621-638.e17

PubMed ID: 30554943 DOI: 10.1016/j.molcel.2018.11.006

Larsen DH, Hari F, Clapperton JA, Gwerder M, Gutsche K, Altmeyer M, Jungmichel S, Toledo LI, Fink D, Rask MB, Grøfte M, Lukas C, Nielsen ML, Smerdon SJ, Lukas J, Stucki M

The NBS1-Treacle complex controls ribosomal RNA transcription in response to DNA damage.

Nat Cell Biol , 2014 Aug; 16(8):792-803. Epub 2014 Jul 27

PubMed ID: 25064736 DOI: 10.1038/ncb3007

Did we miss your publication?

Have you published using HPA038237? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch