Enhanced Validation

Polyclonal Anti-SP140 Antibody

SP140 nuclear body protein
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SP140
Alternative Gene Names
LYSP100-A, LYSP100-B
Open Datasheet
Price
$505.00
Product Number
HPA006162
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA006162 antibody. Corresponding SP140 RNA-seq data are presented for the same tissues.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
SP140 nuclear body protein
Target Gene
SP140
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000022800 (32%)

Mouse ENSMUSG00000079808 (30%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA006162 on the Human Protein Atlas
Protein Name
SP140 nuclear body protein
Gene Name
SP140
Alternative Gene Names
LYSP100-A, LYSP100-B
UniProt ID
Q13342
Gene (Ensembl)
ENSG00000079263
Entrez Gene ID
Entrez gene: 11262
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000079263 on the Human Protein Atlas

Ghiboub M, Koster J, Craggs PD, Li Yim AY, Shillings A, Hutchinson S, Bingham RP, Gatfield K, Hageman IL, Yao G, O’Keefe HP, Coffin A, Patel A, Sloan LA, Mitchell DJ, Hayhow TG, Lunven L, Watson RJ, Blunt CE, Harrison LA, Bruton G, Kumar U, Hamer N, Spaull JR, Zwijnenburg DA, Welting O, Hakvoort TB, te Velde AA, van Limbergen J, Henneman P, Prinjha RK, de Winther MP, Harker NR, Tough DF, de Jonge WJ

Modulation of macrophage inflammatory function through selective inhibition of the epigenetic reader protein SP140

BMC Biol , 2022 Aug 19; 20:182. Epub 2022 Aug 19

PubMed ID: 35986286 DOI: 10.1186/s12915-022-01380-6

Mehta S, Cronkite DA, Basavappa M, Saunders TL, Adiliaghdam F, Amatullah H, Morrison SA, Pagan JD, Anthony RM, Tonnerre P, Lauer GM, Lee JC, Digumarthi S, Pantano L, Ho Sui SJ, Ji F, Sadreyev R, Zhou C, Mullen AC, Kumar V, Li Y, Wijmenga C, Xavier RJ, Means TK, Jeffrey KL

Maintenance of macrophage transcriptional programs and intestinal homeostasis by epigenetic reader SP140

Sci Immunol , 2017 Mar 3; 2(9):eaag3160. Epub 2017 Mar 3

PubMed ID: 28783698 DOI: 10.1126/sciimmunol.aag3160

Did we miss your publication?

Have you published using HPA006162? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-SP140 (HPA067493)
Corresponding Antigens
PrEST Antigen SP140 (APrEST70859)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch