Enhanced Validation

Anti-SNX9 Antibody

sorting nexin 9
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human SNX9
Alternative Gene Names
SDP1, SH3PX1, SH3PXD3A
Price
$450.00
Product Number
HPA031410
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
sorting nexin 9
Target Gene
SNX9
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000002365 (88%)

Rat ENSRNOG00000046874 (62%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
sorting nexin 9
Gene Name
SNX9
Alternative Gene Names
SDP1, SH3PX1, SH3PXD3A
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000130340 on the Human Protein Atlas

Echarri A, Pavón DM, Sánchez S, García-García M, Calvo E, Huerta-López C, Velázquez-Carreras D, Viaris de Lesegno C, Ariotti N, Lázaro-Carrillo A, Strippoli R, De Sancho D, Alegre-Cebollada J, Lamaze C, Parton RG, Del Pozo MA

An Abl-FBP17 mechanosensing system couples local plasma membrane curvature and stress fiber remodeling during mechanoadaptation

Nat Commun , 2019 Dec 20; 10:5828. Epub 2019 Dec 20

PubMed ID: 31862885 DOI: 10.1038/s41467-019-13782-2

Wrobel AG, Kadlecova Z, Kamenicky J, Yang JC, Herrmann T, Kelly BT, McCoy AJ, Evans PR, Martin S, Müller S, Sroubek F, Neuhaus D, Honing S, Owen DJ

Temporal Ordering in Endocytic Clathrin-Coated Vesicle Formation via AP2 Phosphorylation

Dev Cell , 2019 Aug 19; 50(4):494-508.e11

PubMed ID: 31430451 DOI: 10.1016/j.devcel.2019.07.017

Carim SC, Ben El Kadhi K, Yan G, Sweeney ST, Hickson GR, Carréno S, Lowe M

IPIP27 Coordinates PtdIns(4,5)P2 Homeostasis for Successful Cytokinesis

Curr Biol , 2019 Mar 4; 29(5):775-789.e7

PubMed ID: 30799246 DOI: 10.1016/j.cub.2019.01.043

Tanigawa K, Maekawa M, Kiyoi T, Nakayama J, Kitazawa R, Kitazawa S, Semba K, Taguchi T, Akita S, Yoshida M, Ishimaru K, Watanabe Y, Higashiyama S

SNX9 determines the surface levels of integrin β1 in vascular endothelial cells: Implication in poor prognosis of human colorectal cancers overexpressing SNX9

J Cell Physiol , 2019 Feb 19; 234(10):17280-17294. Epub 2019 Feb 19

PubMed ID: 30784076 DOI: 10.1002/jcp.28346

Liu C, Zhai X, Du H, Cao Y, Cao H, Wang Y, Yu X, Gao J, Xu Z

Sorting nexin 9 (SNX9) is not essential for development and auditory function in mice

Oncotarget , 2016 Sep 15; 7(42):68921-68932. Epub 2016 Sep 15

PubMed ID: 27655699 DOI: 10.18632/oncotarget.12040

Bendris N, Stearns CJ, Reis CR, Rodriguez-Canales J, Liu H, Witkiewicz AW, Schmid SL

Sorting nexin 9 negatively regulates invadopodia formation and function in cancer cells

J Cell Sci , 2016 Jul 15; 129(14):2804-2816

PubMed ID: 27278018 DOI: 10.1242/jcs.188045

Bendris N, Williams KC, Reis CR, Welf ES, Chen PH, Lemmers B, Hahne M, Leong HS, Schmid SL

SNX9 promotes metastasis by enhancing cancer cell invasion via differential regulation of RhoGTPases

Mol Biol Cell , 2016 May 1; 27(9):1409-1419

PubMed ID: 26960793 DOI: 10.1091/mbc.E16-02-0101

Did we miss your publication?

Have you published using HPA031410? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch