Enhanced Validation

Anti-SLC3A2 Antibody

solute carrier family 3 (amino acid transporter heavy chain), member 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human SLC3A2
Alternative Gene Names
4F2, 4F2HC, 4T2HC, CD98, CD98HC, MDU1, NACAE
Price
$445.00
Product Number
HPA017980
Unit Size
Concentration
Lot dependent
Availability
9 in Stock
Ships
Ready to Ship
Target Protein
solute carrier family 3 (amino acid transporter heavy chain), member 2
Target Gene
SLC3A2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000018487 (74%)

Mouse ENSMUSG00000010095 (70%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
solute carrier family 3 (amino acid transporter heavy chain), member 2
Gene Name
SLC3A2
Alternative Gene Names
4F2, 4F2HC, 4T2HC, CD98, CD98HC, MDU1, NACAE
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000168003 on the Human Protein Atlas

Alfarsi LH, El-Ansari R, Craze ML, Masisi BK, Mohammed OJ, Ellis IO, Rakha EA, Green AR

Co-Expression Effect of SLC7A5/SLC3A2 to Predict Response to Endocrine Therapy in Oestrogen-Receptor-Positive Breast Cancer

Int J Mol Sci , 2020 Feb 19; 21(4):1407. Epub 2020 Feb 19

PubMed ID: 32093034 DOI: 10.3390/ijms21041407

Lane DJ, Bae DH, Siafakas AR, Rahmanto YS, Al-Akra L, Jansson PJ, Casero RA Jr, Richardson DR

COUPLING OF THE POLYAMINE AND IRON METABOLISM PATHWAYS IN THE REGULATION OF PROLIFERATION: MECHANISTIC LINKS TO ALTERATIONS IN KEY POLYAMINE BIOSYNTHETIC AND CATABOLIC ENZYMES

Biochim Biophys Acta Mol Basis Dis , 2018 May 16; 1864(9 Pt B):2793-2813. Epub 2018 May 16

PubMed ID: 29777905 DOI: 10.1016/j.bbadis.2018.05.007

El Ansari R, Craze ML, Diez-Rodriguez M, Nolan CC, Ellis IO, Rakha EA, Green AR

The multifunctional solute carrier 3A2 (SLC3A2) confers a poor prognosis in the highly proliferative breast cancer subtypes

Br J Cancer , 2018 Mar 16; 118(8):1115-1122. Epub 2018 Mar 16

PubMed ID: 29545595 DOI: 10.1038/s41416-018-0038-5

Did we miss your publication?

Have you published using HPA017980? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch