Anti-SLC16A2 Antibody

solute carrier family 16, member 2 (thyroid hormone transporter)
Recommended Applications
Product Description
Polyclonal Antibody against Human SLC16A2
Alternative Gene Names
AHDS, DXS128, MCT7, MCT8, MRX22, XPCT
Price
$450.00
Product Number
HPA003353
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
solute carrier family 16, member 2 (thyroid hormone transporter)
Target Gene
SLC16A2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSRNKYQPQSGSSGPSSHSPPAAMALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPT
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000002832 (61%)

Mouse ENSMUSG00000033965 (61%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
solute carrier family 16, member 2 (thyroid hormone transporter)
Gene Name
SLC16A2
Alternative Gene Names
AHDS, DXS128, MCT7, MCT8, MRX22, XPCT
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000147100 on the Human Protein Atlas

Mayerl S, Schmidt M, Doycheva D, Darras VM, Hüttner SS, Boelen A, Visser TJ, Kaether C, Heuer H, von Maltzahn J

Thyroid Hormone Transporters MCT8 and OATP1C1 Control Skeletal Muscle Regeneration

Stem Cell Reports , 2018 Apr 26; 10(6):1959-1974. Epub 2018 Apr 26

PubMed ID: 29706500 DOI: 10.1016/j.stemcr.2018.03.021

Qatato M, Szumska J, Skripnik V, Rijntjes E, Köhrle J, Brix K

Canonical TSH Regulation of Cathepsin-Mediated Thyroglobulin Processing in the Thyroid Gland of Male Mice Requires Taar1 Expression

Front Pharmacol , 2018 Mar 20; 9:221. Epub 2018 Mar 20

PubMed ID: 29615904 DOI: 10.3389/fphar.2018.00221

Iwayama H, Liao XH, Braun L, Bárez-López S, Kaspar B, Weiss RE, Dumitrescu AM, Guadaño-Ferraz A, Refetoff S

Adeno Associated Virus 9–Based Gene Therapy Delivers a Functional Monocarboxylate Transporter 8, Improving Thyroid Hormone Availability to the Brain of Mct8-Deficient Mice

Thyroid , 2016 Sep 1; 26(9):1311-1319. Epub 2016 Sep 1

PubMed ID: 27432638 DOI: 10.1089/thy.2016.0060

Henning Y, Szafranski K

Age-Dependent Changes of Monocarboxylate Transporter 8 Availability in the Postnatal Murine Retina

Front Cell Neurosci , 2016 Aug 26; 10:205. Epub 2016 Aug 26

PubMed ID: 27616981 DOI: 10.3389/fncel.2016.00205

Did we miss your publication?

Have you published using HPA003353? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch