Enhanced Validation

Anti-SGMS2 Antibody

sphingomyelin synthase 2
References (1)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SGMS2
Alternative Gene Names
MGC26963, SMS2
Open Datasheet
Price
$450.00
Product Number
HPA015076
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[6 pictures]
Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using HPA015076 antibody. Corresponding SGMS2 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
sphingomyelin synthase 2
Target Gene
SGMS2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000011284 (73%)

Mouse ENSMUSG00000050931 (73%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA015076 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
sphingomyelin synthase 2
Gene Name
SGMS2
Alternative Gene Names
MGC26963, SMS2
UniProt ID
Q8NHU3
Gene (Ensembl)
ENSG00000164023
Entrez Gene ID
Entrez gene: 166929
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000164023 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA015076? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens
PrEST Antigen SGMS2 (APrEST73281)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch