Enhanced Validation

Anti-S100A6 Antibody

S100 calcium binding protein A6
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human S100A6
Alternative Gene Names
2A9, CABP, CACY, PRA
Price
$437.00
Product Number
HPA007575
Unit Size
100 µl
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Target protein
S100 calcium binding protein A6
Target gene
S100A6
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000001025 (96%)

Rat ENSRNOG00000011647 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
S100 calcium binding protein A6
Gene Name
S100A6
Alternative Gene Names
2A9, CABP, CACY, PRA
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000197956 on the Human Protein Atlas

Byström S, Fredolini C, Edqvist PH, Nyaiesh EN, Drobin K, Uhlén M, Bergqvist M, Pontén F, Schwenk JM

Affinity Proteomics Exploration of Melanoma Identifies Proteins in Serum with Associations to T-Stage and Recurrence

Transl Oncol , 2017 Apr 20; 10(3):385-395. Epub 2017 Apr 20

PubMed ID: 28433799 DOI: 10.1016/j.tranon.2017.03.002

Mehdi Damaghi, Narges K. Tafreshi, Mark C. Lloyd, Robert Sprung, Veronica Estrella, Jonathan W. Wojtkowiak, David L. Morse, John M. Koomen, Marilyn M. Bui, Robert A Gatenby, Robert J Gillies

Chronic acidosis in the tumour microenvironment selects for overexpression of LAMP2 in the plasma membrane

Nature Communications , 6, (2015)

PubMed ID: 26658462 DOI: 10.1038/ncomms9752

Did we miss your publication?

Have you published using HPA007575? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch