Anti-RHOT1 Antibody

ras homolog family member T1
Recommended Applications
Product Description
Polyclonal Antibody against Human RHOT1
Alternative Gene Names
ARHT1, FLJ11040, MIRO-1
Price
$445.00
Product Number
HPA010687
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
ras homolog family member T1
Target Gene
RHOT1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000004093 (100%)

Mouse ENSMUSG00000017686 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Protein Name
ras homolog family member T1
Gene Name
RHOT1
Alternative Gene Names
ARHT1, FLJ11040, MIRO-1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000126858 on the Human Protein Atlas

Safiulina D, Kuum M, Choubey V, Gogichaishvili N, Liiv J, Hickey MA, Cagalinec M, Mandel M, Zeb A, Liiv M, Kaasik A

Miro proteins prime mitochondria for Parkin translocation and mitophagy

EMBO J , 2018 Nov 30; 38(2):e99384. Epub 2018 Nov 30

PubMed ID: 30504269 DOI: 10.15252/embj.201899384

Shaltouki A, Hsieh CH, Kim MJ, Wang X

Alpha-Synuclein Delays Mitophagy and Targeting Miro Rescues Neuron Loss in Parkinson’s Models

Acta Neuropathol , 2018 Jun 9; 136(4):607-620. Epub 2018 Jun 9

PubMed ID: 29923074 DOI: 10.1007/s00401-018-1873-4

McLelland GL, Goiran T, Yi W, Dorval G, Chen CX, Lauinger ND, Krahn AI, Valimehr S, Rakovic A, Rouiller I, Durcan TM, Trempe JF, Fon EA

Mfn2 ubiquitination by PINK1/parkin gates the p97-dependent release of ER from mitochondria to drive mitophagy

eLife , 2018 Apr 20; 7:e32866. Epub 2018 Apr 20

PubMed ID: 29676259 DOI: 10.7554/eLife.32866

Gersch M, Gladkova C, Schubert AF, Michel MA, Maslen S, Komander D

Mechanism and regulation of the Lys6-selective deubiquitinase USP30

Nat Struct Mol Biol , 2017 Sep 25; 24(11):920-930. Epub 2017 Sep 25

PubMed ID: 28945249 DOI: 10.1038/nsmb.3475

Zhou B, Yu P, Lin MY, Sun T, Chen Y, Sheng ZH

Facilitation of axon regeneration by enhancing mitochondrial transport and rescuing energy deficits

J Cell Biol , 2016 Jul 4; 214(1):103-119

PubMed ID: 27268498 DOI: 10.1083/jcb.201605101

Mills KM, Brocardo MG, Henderson BR

APC binds the Miro/Milton motor complex to stimulate transport of mitochondria to the plasma membrane

Mol Biol Cell , 2016/02/01; 27(3):466-482

PubMed ID: 26658612 DOI: 10.1091/mbc.E15-09-0632

Norkett R, Modi S, Birsa N, Atkin TA, Ivankovic D, Pathania M, Trossbach SV, Korth C, Hirst WD, Kittler JT

DISC1-dependent Regulation of Mitochondrial Dynamics Controls the Morphogenesis of Complex Neuronal Dendrites

J Biol Chem , 2016 Jan 8; 291(2):613-629. Epub 2015 Nov 9

PubMed ID: 26553875 DOI: 10.1074/jbc.M115.699447

Stephen TL, Higgs NF, Sheehan DF, Al Awabdh S, López-Doménech G, Arancibia-Carcamo IL, Kittler JT

Miro1 Regulates Activity-Driven Positioning of Mitochondria within Astrocytic Processes Apposed to Synapses to Regulate Intracellular Calcium Signaling

J Neurosci , 2015 Dec 2; 35(48):15996-16011

PubMed ID: 26631479 DOI: 10.1523/JNEUROSCI.2068-15.2015

Gil Kanfer, Thibault Courthéoux, Martin Peterka, Sonja Meier, Martin Soste, Andre Melnik, Katarina Reis, Pontus Aspenström, Matthias Peter, Paola Picotti, Benoît Kornmann

Mitotic redistribution of the mitochondrial network by Miro and Cenp-F

Nature Communications , 6, (2015)

PubMed ID: 26259702 DOI: 10.1038/ncomms9015

Bingol B, Tea JS, Phu L, Reichelt M, Bakalarski CE, Song Q, Foreman O, Kirkpatrick DS, Sheng M

The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.

Nature , 2014 Jun 19; 510(7505):370-5. Epub 2014 Jun 4

PubMed ID: 24896179 DOI: 10.1038/nature13418

Birsa N, Norkett R, Wauer T, Mevissen TE, Wu HC, Foltynie T, Bhatia K, Hirst WD, Komander D, Plun-Favreau H, Kittler JT

Lysine 27 Ubiquitination of the Mitochondrial Transport Protein Miro Is Dependent on Serine 65 of the Parkin Ubiquitin Ligase

J Biol Chem , 2014 May 23; 289(21):14569-14582. Epub 2014 Mar 26

PubMed ID: 24671417 DOI: 10.1074/jbc.M114.563031

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

De Vos KJ, Mórotz GM, Stoica R, Tudor EL, Lau KF, Ackerley S, Warley A, Shaw CE, Miller CC

VAPB interacts with the mitochondrial protein PTPIP51 to regulate calcium homeostasis.

Hum Mol Genet , 2012 Mar 15; 21(6):1299-311. Epub 2011 Nov 30

PubMed ID: 22131369 DOI: 10.1093/hmg/ddr559

Did we miss your publication?

Have you published using HPA010687? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch