Enhanced Validation

Polyclonal Anti-RDX Antibody

radixin
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human RDX
Alternative Gene Names
DFNB24
Open Datasheet
Price
$505.00
Product Number
HPA000763
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[6 pictures]
Immunohistochemistry analysis in human adrenal gland and tonsil tissues using HPA000763 antibody. Corresponding RDX RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human cell line U-251 MG.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
radixin
Target Gene
RDX
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000032050 (97%)

Rat ENSRNOG00000012237 (93%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA000763 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA000763 on the Human Protein Atlas
Protein Name
radixin
Gene Name
RDX
Alternative Gene Names
DFNB24
UniProt ID
P35241
Gene (Ensembl)
ENSG00000137710
Entrez Gene ID
Entrez gene: 5962
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000137710 on the Human Protein Atlas

Asp N, Kvalvaag A, Sandvig K, Pust S

Regulation of ErbB2 localization and function in breast cancer cells by ERM proteins

Oncotarget , 2016 Mar 23; 7(18):25443-25460. Epub 2016 Mar 23

PubMed ID: 27029001 DOI: 10.18632/oncotarget.8327

Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA

From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.

Mol Cell Proteomics , 2006 Jun; 5(6):1072-81. Epub 2006 Mar 8

PubMed ID: 16524965 DOI: 10.1074/mcp.M600077-MCP200

Did we miss your publication?

Have you published using HPA000763? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-RDX (HPA000263)
Corresponding Antigens
PrEST Antigen RDX (APrEST76164)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch