Anti-RBP4 Antibody

retinol binding protein 4, plasma
Recommended Applications
Product Description
Polyclonal Antibody against Human RBP4
Price
$437.00
Product Number
HPA001641
Unit Size
100 µl
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Target protein
retinol binding protein 4, plasma
Target gene
RBP4
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000024990 (90%)

Rat ENSRNOG00000015518 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
Protein Name
retinol binding protein 4, plasma
Gene Name
RBP4
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000138207 on the Human Protein Atlas

Karunanithi S, Levi L, DeVecchio J, Karagkounis G, Reizes O, Lathia JD, Kalady MF, Noy N

RBP4-STRA6 Pathway Drives Cancer Stem Cell Maintenance and Mediates High-Fat Diet-Induced Colon Carcinogenesis

Stem Cell Reports , 2017 Jul 6; 9(2):438-450. Epub 2017 Jul 6

PubMed ID: 28689994 DOI: 10.1016/j.stemcr.2017.06.002

Bouchal P, Jarkovsky J, Hrazdilova K, Dvorakova M, Struharova I, Hernychova L, Damborsky J, Sova P, Vojtesek B

The new platinum-based anticancer agent LA-12 induces retinol binding protein 4 in vivo

Proteome Sci , 2011 Oct 31; 9:68. Epub 2011 Oct 31

PubMed ID: 22040120 DOI: 10.1186/1477-5956-9-68

Kelly KR, Kashyap SR, O'Leary VB, Major J, Schauer PR, Kirwan JP

Retinol-binding Protein 4 (RBP4) Protein Expression Is Increased in Omental Adipose Tissue of Severely Obese Patients

Obesity (Silver Spring) , 2010 Apr; 18(4):663-666. Epub 2009 Oct 8

PubMed ID: 19816414 DOI: 10.1038/oby.2009.328

Did we miss your publication?

Have you published using HPA001641? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens