Enhanced Validation

Anti-PTGES Antibody

prostaglandin E synthase
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human PTGES
Alternative Gene Names
MGST-IV, MGST1-L1, MGST1L1, PIG12, TP53I12
Price
$450.00
Product Number
HPA045064
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
prostaglandin E synthase
Target Gene
PTGES
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000006320 (91%)

Mouse ENSMUSG00000050737 (86%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
prostaglandin E synthase
Gene Name
PTGES
Alternative Gene Names
MGST-IV, MGST1-L1, MGST1L1, PIG12, TP53I12
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000148344 on the Human Protein Atlas

Cao Y, Lu X, Li Y, Fu J, Li H, Li X, Chang Z, Liu S

Identification of a six-gene metabolic signature predicting overall survival for patients with lung adenocarcinoma

PeerJ , 2020 Dec 2; 8:e10320. Epub 2020 Dec 2

PubMed ID: 33344071 DOI: 10.7717/peerj.10320

Dilmé JF, Solà-Villà D, Bellmunt S, Romero JM, Escudero JR, Camacho M, Vila L

Active Smoking Increases Microsomal PGE2-Synthase-1/PGE-Receptor-4 Axis in Human Abdominal Aortic Aneurysms

Mediators Inflamm , 2014; 2014:316150. Epub 2014 Apr 30

PubMed ID: 24876670 DOI: 10.1155/2014/316150

Camacho M, Dilmé J, Solà-Villà D, Rodríguez C, Bellmunt S, Siguero L, Alcolea S, Romero JM, Escudero JR, Martínez-González J, Vila L

Microvascular COX-2/mPGES-1/EP-4 axis in human abdominal aortic aneurysm

J Lipid Res , 2013 Dec; 54(12):3506-3515

PubMed ID: 24133193 DOI: 10.1194/jlr.M042481

Did we miss your publication?

Have you published using HPA045064? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch