Enhanced Validation

Anti-PPP1R8 Antibody

protein phosphatase 1, regulatory subunit 8
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human PPP1R8
Alternative Gene Names
ard-1, ARD1, NIPP-1, NIPP1, PRO2047
Price
$437.00
Product Number
HPA027406
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
protein phosphatase 1, regulatory subunit 8
Target gene
PPP1R8
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000028882 (98%)

Rat ENSRNOG00000059550 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibodies Anti-PPP1R8 HPA027452, Anti-PPP1R8 HPA027417.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
protein phosphatase 1, regulatory subunit 8
Gene Name
PPP1R8
Alternative Gene Names
ard-1, ARD1, NIPP-1, NIPP1, PRO2047
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000117751 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA027406? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch