Enhanced Validation

Anti-POLA1 Antibody

polymerase (DNA directed), alpha 1, catalytic subunit
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human POLA1
Alternative Gene Names
NSX, p180, POLA
Price
$445.00
Product Number
HPA002947
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
polymerase (DNA directed), alpha 1, catalytic subunit
Target Gene
POLA1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000013322 (76%)

Mouse ENSMUSG00000006678 (75%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
polymerase (DNA directed), alpha 1, catalytic subunit
Gene Name
POLA1
Alternative Gene Names
NSX, p180, POLA
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000101868 on the Human Protein Atlas

Petro Starokadomskyy, Terry Gemelli, Jonathan J Rios, Chao Xing, Richard C Wang, Haiying Li, Vladislav Pokatayev, Igor Dozmorov, Shaheen Khan, Naoteru Miyata, Guadalupe Fraile, Prithvi Raj, Zhe Xu, Zigang Xu, Lin Ma, Zhimiao Lin, Huijun Wang, Yong Yang, Dan Ben-Amitai, Naama Orenstein, Huda Mussaffi, Eulalia Baselga, Gianluca Tadini, Eyal Grunebaum, Adrijan Sarajlija, Konrad Krzewski, Edward K Wakeland, Nan Yan, Maria Teresa de la Morena, Andrew R Zinn, Ezra Burstein

DNA polymerase-α regulates the activation of type I interferons through cytosolic RNA:DNA synthesis

Nature Immunology , March 28, 2016

PubMed ID: 0 DOI: 10.1038/ni.3409

Starokadomskyy P, Gemelli T, Rios JJ, Xing C, Wang RC, Li H, Pokatayev V, Dozmorov I, Khan S, Miyata N, Fraile G, Raj P, Xu Z, Xu Z, Ma L, Lin Z, Wang H, Yang Y, Ben-Amitai D, Orenstein N, Mussaffi H, Baselga E, Tadini G, Grunebaum E, Sarajlija A, Krzewski K, Wakeland EK, Yan N, de la Morena MT, Zinn AR, Burstein E

DNA polymerase-α regulates type I interferon activation through cytosolic RNA:DNA synthesis

Nat Immunol , 2016 Mar 28; 17(5):495-504. Epub 2016 Mar 28

PubMed ID: 27019227 DOI: 10.1038/ni.3409

Fujita T, Asano Y, Ohtsuka J, Takada Y, Saito K, Ohki R, Fujii H

Identification of telomere-associated molecules by engineered DNA-binding molecule-mediated chromatin immunoprecipitation (enChIP)

Sci Rep , 2013 Nov 8; 3:3171. Epub 2013 Nov 8

PubMed ID: 24201379 DOI: 10.1038/srep03171

Did we miss your publication?

Have you published using HPA002947? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch