Enhanced Validation

Anti-PERM1 Antibody

PPARGC1 and ESRR induced regulator, muscle 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PERM1
Alternative Gene Names
C1orf170, MGC13275, Perm1, RP11-54O7.8
Price
$445.00
Product Number
HPA031711
Unit Size
Concentration
Lot dependent
Availability
2 in Stock
Ships
Ready to Ship
Target Protein
PPARGC1 and ESRR induced regulator, muscle 1
Target Gene
PERM1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020244 (62%)

Mouse ENSMUSG00000078486 (61%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
PPARGC1 and ESRR induced regulator, muscle 1
Gene Name
PERM1
Alternative Gene Names
C1orf170, MGC13275, Perm1, RP11-54O7.8
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000187642 on the Human Protein Atlas

Cho Y, Tachibana S, Hazen BC, Moresco JJ, Yates JR III, Kok B, Saez E, Ross RS, Russell AP, Kralli A

Perm1 regulates CaMKII activation and shapes skeletal muscle responses to endurance exercise training

Mol Metab , 2019 Feb 27; 23:88-97. Epub 2019 Feb 27

PubMed ID: 30862473 DOI: 10.1016/j.molmet.2019.02.009

Did we miss your publication?

Have you published using HPA031711? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch