Enhanced Validation

Anti-P2RY12 Antibody

purinergic receptor P2Y, G-protein coupled, 12
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human P2RY12
Alternative Gene Names
HORK3, P2Y12, SP1999
Price
$437.00
Product Number
HPA014518
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
purinergic receptor P2Y, G-protein coupled, 12
Target gene
P2RY12
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000036353 (70%)

Rat ENSRNOG00000013902 (63%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
purinergic receptor P2Y, G-protein coupled, 12
Gene Name
P2RY12
Alternative Gene Names
HORK3, P2Y12, SP1999
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000169313 on the Human Protein Atlas

Ma W, Silverman SM, Zhao L, Villasmil R, Campos MM, Amaral J, Wong WT

Absence of TGFβ signaling in retinal microglia induces retinal degeneration and exacerbates choroidal neovascularization

eLife , 2019 Jan 22; 8:e42049. Epub 2019 Jan 22

PubMed ID: 30666961 DOI: 10.7554/eLife.42049

McQuade A, Coburn M, Tu CH, Hasselmann J, Davtyan H, Blurton-Jones M

Development and validation of a simplified method to generate human microglia from pluripotent stem cells

Mol Neurodegener , 2018 Dec 22; 13:67. Epub 2018 Dec 22

PubMed ID: 30577865 DOI: 10.1186/s13024-018-0297-x

Zarate MA, Rodriguez MD, Chang EI, Russell JT, Arndt TJ, Richards EM, Ocasio BA, Aranda E, Gordon EM, Yu K, Neu J, Keller-Wood M, Triplett EW, Wood CE

Post-hypoxia Invasion of the fetal brain by multidrug resistant Staphylococcus

Sci Rep , 2017 Jul 25; 7:6458. Epub 2017 Jul 25

PubMed ID: 28743956 DOI: 10.1038/s41598-017-06789-6

Mildner A

Ghosts in the shell: identification of microglia in the human central nervous system by P2Y12 receptor

Neural Regen Res , 2017 Apr; 12(4):570-571

PubMed ID: 28553330 DOI: 10.4103/1673-5374.205090

Abud EM, Ramirez RN, Martinez ES, Healy LM, Nguyen CH, Newman SA, Yeromin AV, Scarfone VM, Marsh SE, Fimbres C, Caraway CA, Fote GM, Madany AM, Agrawal A, Kayed R, Gylys KH, Cahalan MD, Cummings BJ, Antel JP, Mortazavi A, Carson MJ, Poon WW, Blurton-Jones M

iPSC-derived human microglia-like cells to study neurological diseases

Neuron , 2017 Apr 19; 94(2):278-293.e9

PubMed ID: 28426964 DOI: 10.1016/j.neuron.2017.03.042

Did we miss your publication?

Have you published using HPA014518? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch