Enhanced Validation

Anti-NFIA Antibody

nuclear factor I/A
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human NFIA
Alternative Gene Names
KIAA1439, NFI-L
Price
$437.00
Product Number
HPA006111
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target protein
nuclear factor I/A
Target gene
NFIA
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQ
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000006966 (100%)

Mouse ENSMUSG00000028565 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-NFIA HPA008884.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
nuclear factor I/A
Gene Name
NFIA
Alternative Gene Names
KIAA1439, NFI-L
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000162599 on the Human Protein Atlas

Keeley PW, Reese BE

DNER and NFIA are Expressed by Developing and Mature AII Amacrine Cells in the Mouse Retina

J Comp Neurol , 2017 Nov 11; 526(3):467-479. Epub 2017 Nov 11

PubMed ID: 29071714 DOI: 10.1002/cne.24345

Doi T, Ogata T, Yamauchi J, Sawada Y, Tanaka S, Nagao M

Chd7 Collaborates with Sox2 to Regulate Activation of Oligodendrocyte Precursor Cells after Spinal Cord Injury

J Neurosci , 2017 Oct 25; 37(43):10290-10309

PubMed ID: 28931573 DOI: 10.1523/JNEUROSCI.1109-17.2017

Nagao M, Ogata T, Sawada Y, Gotoh Y

Zbtb20 promotes astrocytogenesis during neocortical development

Nat Commun , 1/01/01; 7:11102. Epub 2016 Mar 22

PubMed ID: 27000654 DOI: 10.1038/ncomms11102

Did we miss your publication?

Have you published using HPA006111? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch