Enhanced Validation

Anti-NF2 Antibody

neurofibromin 2 (merlin)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human NF2
Alternative Gene Names
merlin
Price
$437.00
Product Number
HPA003097
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
neurofibromin 2 (merlin)
Target gene
NF2
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000009073 (94%)

Rat ENSRNOG00000007948 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
neurofibromin 2 (merlin)
Gene Name
NF2
Alternative Gene Names
merlin
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000186575 on the Human Protein Atlas

Chen H, Xue L, Huang H, Wang H, Zhang X, Zhu W, Wang Z, Wang Z, Wu H

Synergistic effect of Nutlin-3 combined with MG-132 on schwannoma cells through restoration of merlin and p53 tumour suppressors

EBioMedicine , 2018 Sep 28; 36:252-265. Epub 2018 Sep 28

PubMed ID: 30274821 DOI: 10.1016/j.ebiom.2018.09.042

Toledo A, Grieger E, Karram K, Morrison H, Baader SL

Neurofibromatosis type 2 tumor suppressor protein is expressed in oligodendrocytes and regulates cell proliferation and process formation

PLoS One , 2018 May 1; 13(5):e0196726. Epub 2018 May 1

PubMed ID: 29715273 DOI: 10.1371/journal.pone.0196726

Moon KH, Kim HT, Lee D, Rao MB, Levine EM, Lim DS, Kim JW

Differential expression of NF2 in neuroepithelial compartments is necessary for mammalian eye development

Dev Cell , 2017 Dec 14; 44(1):13-28.e3. Epub 2017 Dec 14

PubMed ID: 29249622 DOI: 10.1016/j.devcel.2017.11.011

Chen H, Xue L, Wang H, Wang Z, Wu H

Differential NF2 Gene Status in Sporadic Vestibular Schwannomas and its Prognostic Impact on Tumour Growth Patterns

Sci Rep , 2017 Jul 14; 7:5470. Epub 2017 Jul 14

PubMed ID: 28710469 DOI: 10.1038/s41598-017-05769-0

Li X, Chen H, Xue L, Pang X, Zhang X, Zhu Z, Zhu W, Wang Z, Wu H

p53 performs an essential role in mediating the oncogenic stimulus triggered by loss of expression of neurofibromatosis type 2 during in vitro tumor progression

Oncol Lett , 2017 Jun 21; 14(2):2223-2231. Epub 2017 Jun 21

PubMed ID: 28789444 DOI: 10.3892/ol.2017.6445

Reginensi A, Enderle L, Gregorieff A, Johnson RL, Wrana JL, McNeill H

A critical role for NF2 and the Hippo pathway in branching morphogenesis

Nat Commun , 2016 Aug 2; 7:12309. Epub 2016 Aug 2

PubMed ID: 27480037 DOI: 10.1038/ncomms12309

Chen Q, Zhang N, Xie R, Wang W, Cai J, Choi KS, David KK, Huang B, Yabuta N, Nojima H, Anders RA, Pan D

Homeostatic control of Hippo signaling activity revealed by an endogenous activating mutation in YAP

Genes Dev , 2015 Jun 15; 29(12):1285-1297

PubMed ID: 26109051 DOI: 10.1101/gad.264234.115

Serinagaoglu Y, Paré J, Giovannini M, Cao X

Nf2-Yap signaling controls the expansion of DRG progenitors and glia during DRG development

Dev Biol , 2015/02/01; 398(1):97-109. Epub 2014 Nov 26

PubMed ID: 25433207 DOI: 10.1016/j.ydbio.2014.11.017

Lavado A, He Y, Paré J, Neale G, Olson EN, Giovannini M, Cao X

Tumor suppressor Nf2 limits expansion of the neural progenitor pool by inhibiting Yap/Taz transcriptional coactivators

Development , 2013 Aug; 140(16):3323-3334

PubMed ID: 23863479 DOI: 10.1242/dev.096537

Zhang N, Bai H, David KK, Dong J, Zheng Y, Cai J, Giovannini M, Liu P, Anders RA, Pan D

The Merlin/NF2 tumor suppressor functions through the YAP oncoprotein to regulate tissue homeostasis in mammals

Dev Cell , 2010 Jul 20; 19(1):27-38

PubMed ID: 20643348 DOI: 10.1016/j.devcel.2010.06.015

Did we miss your publication?

Have you published using HPA003097? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens