Enhanced Validation

Polyclonal Anti-MPO Antibody

myeloperoxidase
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MPO
Price
$459.00
Product Number
HPA061464
Unit Size
Concentration
Lot dependent
Availability
9 in Stock
Ships
Ready to Ship
Target Protein
myeloperoxidase
Target Gene
MPO
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000009350 (76%)

Rat ENSRNOG00000008310 (74%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-MPO HPA021147.

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
myeloperoxidase
Gene Name
MPO
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000005381 on the Human Protein Atlas

Omeljaniuk WJ, Jabłońska E, Garley M, Pryczynicz A, Ratajczak-Wrona W, Socha K, Borawska MH, Charkiewicz AE

Biomarkers of neutrophil extracellular traps (NETs) and nitric oxide-(NO)-dependent oxidative stress in women who miscarried

Sci Rep , 2020 Aug 4; 10:13088. Epub 2020 Aug 4

PubMed ID: 32753622 DOI: 10.1038/s41598-020-70106-x

Månberg A, Bradley F, Qundos U, Guthrie BL, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener AD, Nilsson P, Broliden K

A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection

Mol Cell Proteomics , 2019 Mar; 18(3):461-476

PubMed ID: 30504243 DOI: 10.1074/mcp.RA118.000757

Did we miss your publication?

Have you published using HPA061464? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch