Anti-MKLN1 Antibody

muskelin 1, intracellular mediator containing kelch motifs
Recommended Applications
Product Description
Polyclonal Antibody against Human MKLN1
Alternative Gene Names
TWA2
Price
$450.00
Product Number
HPA022817
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
muskelin 1, intracellular mediator containing kelch motifs
Target Gene
MKLN1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000054514 (96%)

Mouse ENSMUSG00000025609 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
Protein Name
muskelin 1, intracellular mediator containing kelch motifs
Gene Name
MKLN1
Alternative Gene Names
TWA2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000128585 on the Human Protein Atlas

Boldt K, van Reeuwijk J, Lu Q, Koutroumpas K, Nguyen TM, Texier Y, van Beersum SE, Horn N, Willer JR, Mans DA, Dougherty G, Lamers IJ, Coene KL, Arts HH, Betts MJ, Beyer T, Bolat E, Gloeckner CJ, Haidari K, Hetterschijt L, Iaconis D, Jenkins D, Klose F, Knapp B, Latour B, Letteboer SJ, Marcelis CL, Mitic D, Morleo M, Oud MM, Riemersma M, Rix S, Terhal PA, Toedt G, van Dam TJ, de Vrieze E, Wissinger Y, Wu KM, Apic G, Beales PL, Blacque OE, Gibson TJ, Huynen MA, Katsanis N, Kremer H, Omran H, van Wijk E, Wolfrum U, Kepes F, Davis EE, Franco B, Giles RH, Ueffing M, Russell RB, Roepman R, UK10K Rare Diseases GroupAl-TurkiSaeedS2122AndersonCarlC22AntonyDinuD13BarrosoInêsI21BenthamJamieJ23BhattacharyaShoumoS23CarssKerenK21ChatterjeeKrishnaK24CirakSebahattinS25CosgroveCatherineC23DanecekPetrP21DurbinRichardR21FitzpatrickDavidD26FloydJamieJ21Reghan FoleyA.A25FranklinChrisC21FutemaMartaM27HumphriesSteve E.SE27HurlesMattM21JoyceChrisC21McCarthyShaneS21MitchisonHannah M.HM13MuddymanDawnD21MuntoniFrancescoF25O'RahillyStephenS24OnoufriadisAlexandrosA13PayneFelicityF21PlagnolVincentV28RaymondLucyL29SavageDavid B.DB24ScamblerPeterP13SchmidtsMiriamM13SchoenmakersNadiaN24SempleRobertR24SerraEvaE21StalkerJimJ21van KogelenbergMargrietM21VijayarangakannanParthibanP21WalterKlaudiaK21WhittallRosR27WilliamsonKathyK26

An organelle-specific protein landscape identifies novel diseases and molecular mechanisms

Nat Commun , 13/05/16 ; 7:11491. Epub 2016 May 13

PubMed ID: 27173435 DOI: 10.1038/ncomms11491

DeBenedittis P, Harmelink C, Chen Y, Wang Q, Jiao K

Characterization of the novel interaction between muskelin and TBX20, a critical cardiogenic transcription factor

Biochem Biophys Res Commun , 2011 Jun 3; 409(2):338-343. Epub 2011 May 8

PubMed ID: 21586270 DOI: 10.1016/j.bbrc.2011.05.020

Did we miss your publication?

Have you published using HPA022817? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch