Anti-MAFB Antibody

v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B
Recommended Applications
Product Description
Polyclonal Antibody against Human MAFB
Alternative Gene Names
KRML
Price
$437.00
Product Number
HPA005653
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B
Target gene
MAFB
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000074622 (98%)

Rat ENSRNOG00000016037 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Protein Name
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B
Gene Name
MAFB
Alternative Gene Names
KRML
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000204103 on the Human Protein Atlas

Pai EL, Vogt D, Clemente-Perez A, McKinsey GL, Oho FS, Hu JS, Wimer M, Paul A, Darbandi SF, Pla R, Nowakowski TJ, Goodrich LV, Paz JT, Rubenstein JL

Mafb and c-Maf Have Prenatal Compensatory and Postnatal Antagonistic Roles in Cortical Interneuron Fate and Function

Cell Rep , 2019 Jan 29; 26(5):1157-1173.e5

PubMed ID: 30699346 DOI: 10.1016/j.celrep.2019.01.031

Sweeney LB, Bikoff JB, Gabitto MI, Brenner-Morton S, Baek M, Yang JH, Tabak EG, Dasen JS, Kintner CR, Jessell TM

Origin and Segmental Diversity of Spinal Inhibitory Interneurons

Neuron , 2018 Jan 4; 97(2):341-355.e3. Epub 2018 Jan 4

PubMed ID: 29307712 DOI: 10.1016/j.neuron.2017.12.029

Nishimura K, Noda T, Dabdoub A

Dynamic Expression of Sox2, Gata3, and Prox1 during Primary Auditory Neuron Development in the Mammalian Cochlea

PLoS One , 2017 Jan 24; 12(1):e0170568. Epub 2017 Jan 24

PubMed ID: 28118374 DOI: 10.1371/journal.pone.0170568

Johnson Chacko L, Pechriggl EJ, Fritsch H, Rask-Andersen H, Blumer MJ, Schrott-Fischer A, Glueckert R

Neurosensory Differentiation and Innervation Patterning in the Human Fetal Vestibular End Organs between the Gestational Weeks 8–12

Front Neuroanat , 2016 Nov 15; 10:111. Epub 2016 Nov 15

PubMed ID: 27895556 DOI: 10.3389/fnana.2016.00111

Brunskill EW, Park JS, Chung E, Chen F, Magella B, Potter SS

Single cell dissection of early kidney development: multilineage priming

Development , 2014 Aug; 141(15):3093-3101

PubMed ID: 25053437 DOI: 10.1242/dev.110601

Pasquali L, Gaulton KJ, Rodríguez-Seguí SA, Mularoni L, Miguel-Escalada I, Akerman İ, Tena JJ, Morán I, Gómez-Marín C, van de Bunt M, Ponsa-Cobas J, Castro N, Nammo T, Cebola I, García-Hurtado J, Maestro MA, Pattou F, Piemonti L, Berney T, Gloyn AL, Ravassard P, Skarmeta JL, Müller F, McCarthy MI, Ferrer J

Pancreatic islet enhancer clusters enriched in type 2 diabetes risk–associated variants

Nat Genet , 2014 Feb; 46(2):136-143. Epub 2014 Jan 12

PubMed ID: 24413736 DOI: 10.1038/ng.2870

Did we miss your publication?

Have you published using HPA005653? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens