Enhanced Validation

Anti-LRRC3B Antibody

leucine rich repeat containing 3B
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human LRRC3B
Alternative Gene Names
LRP15
Price
$437.00
Product Number
HPA015568
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
leucine rich repeat containing 3B
Target gene
LRRC3B
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000005857 (100%)

Mouse ENSMUSG00000045201 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
leucine rich repeat containing 3B
Gene Name
LRRC3B
Alternative Gene Names
LRP15
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000179796 on the Human Protein Atlas

Li GS, Kong GY, Zou Y

Protective role of LRRC3B in preventing breast cancer metastasis and recurrence post-bupivacaine

Oncol Lett , 2017 Aug 18; 14(4):5013-5017. Epub 2017 Aug 18

PubMed ID: 29085514 DOI: 10.3892/ol.2017.6773

Did we miss your publication?

Have you published using HPA015568? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens