Enhanced Validation

Anti-LONP1 Antibody

lon peptidase 1, mitochondrial
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human LONP1
Alternative Gene Names
hLON, LonHS, PIM1, PRSS15
Price
$437.00
Product Number
HPA002192
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
lon peptidase 1, mitochondrial
Target gene
LONP1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000041168 (95%)

Rat ENSRNOG00000046502 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Genetic validation in WB by siRNA knockdown.

Protein Name
lon peptidase 1, mitochondrial
Gene Name
LONP1
Alternative Gene Names
hLON, LonHS, PIM1, PRSS15
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000196365 on the Human Protein Atlas

Sprenger H, Wani G, Hesseling A, König T, Patron M, MacVicar T, Ahola S, Wai T, Barth E, Rugarli EI, Bergami M, Langer T

Loss of the mitochondrial i‐AAA protease YME1L leads to ocular dysfunction and spinal axonopathy

EMBO Mol Med , 2018 Nov 2; 11(1):e9288. Epub 2018 Nov 2

PubMed ID: 30389680 DOI: 10.15252/emmm.201809288

Quirós PM, Prado MA, Zamboni N, D’Amico D, Williams RW, Finley D, Gygi SP, Auwerx J

Multi-omics analysis identifies ATF4 as a key regulator of the mitochondrial stress response in mammals

J Cell Biol , 2017 Jul 3; 216(7):2027-2045

PubMed ID: 28566324 DOI: 10.1083/jcb.201702058

Kubota Y, Nomura K, Katoh Y, Yamashita R, Kaneko K, Furuyama K

Novel Mechanisms for Heme-dependent Degradation of ALAS1 Protein as a Component of Negative Feedback Regulation of Heme Biosynthesis

J Biol Chem , 2016 Aug 5; 291(39):20516-20529. Epub 2016 Aug 5

PubMed ID: 27496948 DOI: 10.1074/jbc.M116.719161

Christian Münch, J. Wade Harper

Mitochondrial unfolded protein response controls matrix pre-RNA processing and translation

Nature , June 22, 2016

DOI: 10.1038/nature18302

Richter U, Lahtinen T, Marttinen P, Suomi F, Battersby BJ

Quality control of mitochondrial protein synthesis is required for membrane integrity and cell fitness

J Cell Biol , 2015/10/26; 211(2):373-389

PubMed ID: 26504172 DOI: 10.1083/jcb.201504062

Bahat A, Perlberg S, Melamed-Book N, Lauria I, Langer T, Orly J

StAR Enhances Transcription of Genes Encoding the Mitochondrial Proteases Involved in Its Own Degradation

Mol Endocrinol , 2013 Dec 18; 28(2):208-224. Epub 2013 Dec 18

PubMed ID: 24422629 DOI: 10.1210/me.2013-1275

Gozal YM, Duong DM, Gearing M, Cheng D, Hanfelt JJ, Funderburk C, Peng J, Lah JJ, Levey AI

Proteomics analysis reveals novel components in the detergent-insoluble subproteome in Alzheimer's disease.

J Proteome Res , 2009 Nov; 8(11):5069-79

PubMed ID: 19746990 DOI: 10.1021/pr900474t

Luo B, Wang M, Hou N, Hu X, Jia G, Qin X, Zuo X, Liu Y, Luo K, Song W, Wang K, Pang M

ATP-Dependent Lon Protease Contributes to Helicobacter pylori-Induced Gastric Carcinogenesis

Neoplasia , 1/01/01; 18(4):242-252. Epub 2016 Apr 20

PubMed ID: 27108387 DOI: 10.1016/j.neo.2016.03.001

Did we miss your publication?

Have you published using HPA002192? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens