Enhanced Validation

Anti-KIT Antibody

v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human KIT
Alternative Gene Names
C-Kit, CD117, PBT, SCFR
Price
$445.00
Product Number
HPA004471
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Target Gene
KIT
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000002227 (72%)

Mouse ENSMUSG00000005672 (66%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Gene Name
KIT
Alternative Gene Names
C-Kit, CD117, PBT, SCFR
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000157404 on the Human Protein Atlas

Mudd JC, Busman-Sahay K, DiNapoli SR, Lai S, Sheik V, Lisco A, Deleage C, Richardson B, Palesch DJ, Paiardini M, Cameron M, Sereti I, Reeves RK, Estes JD, Brenchley JM

Hallmarks of primate lentiviral immunodeficiency infection recapitulate loss of innate lymphoid cells

Nat Commun , 2018 Sep 27; 9:3967. Epub 2018 Sep 27

PubMed ID: 30262807 DOI: 10.1038/s41467-018-05528-3

Wang Q, Shen Y, Ye B, Hu H, Fan C, Wang T, Zheng Y, Lv J, Ma Y, Xiang M

Gene expression differences between thyroid carcinoma, thyroid adenoma and normal thyroid tissue

Oncol Rep , 2018 Sep 20; 40(6):3359-3369. Epub 2018 Sep 20

PubMed ID: 30272326 DOI: 10.3892/or.2018.6717

Did we miss your publication?

Have you published using HPA004471? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch