Enhanced Validation

Anti-ITGA3 Antibody

integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human ITGA3
Alternative Gene Names
CD49c, GAP-B3, MSK18, VCA-2, VLA3a
Price
$450.00
Product Number
HPA008572
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
Target Gene
ITGA3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
Verified Species Reactivity
Human, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000001507 (84%)

Rat ENSRNOG00000004276 (82%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Recombinant expression validation in WB using target protein overexpression.

Protein Name
integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
Gene Name
ITGA3
Alternative Gene Names
CD49c, GAP-B3, MSK18, VCA-2, VLA3a
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000005884 on the Human Protein Atlas

Li Q, Ma W, Chen S, Tian EC, Wei S, Fan RR, Wang T, Zhou C, Li T

High integrin α3 expression is associated with poor prognosis in patients with non-small cell lung cancer

Transl Lung Cancer Res , 2020 Aug; 9(4):1361-1378

PubMed ID: 32953510 DOI: 10.21037/tlcr-19-633

Koshizuka K, Hanazawa T, Kikkawa N, Arai T, Okato A, Kurozumi A, Kato M, Katada K, Okamoto Y, Seki N

Regulation of ITGA3 by the anti‐tumor miR‐199 family inhibits cancer cell migration and invasion in head and neck cancer

Cancer Sci , 2017 Jul 4; 108(8):1681-1692. Epub 2017 Jul 4

PubMed ID: 28612520 DOI: 10.1111/cas.13298

Sakaguchi T, Yoshino H, Yonemori M, Miyamoto K, Sugita S, Matsushita R, Itesako T, Tatarano S, Nakagawa M, Enokida H

Regulation of ITGA3 by the dual-stranded microRNA-199 family as a potential prognostic marker in bladder cancer

Br J Cancer , 2017 Mar 21; 116(8):1077-1087. Epub 2017 Mar 21

PubMed ID: 28324890 DOI: 10.1038/bjc.2017.43

Koshizuka K, Nohata N, Hanazawa T, Kikkawa N, Arai T, Okato A, Fukumoto I, Katada K, Okamoto Y, Seki N

Deep sequencing-based microRNA expression signatures in head and neck squamous cell carcinoma: dual strands of pre-miR-150 as antitumor miRNAs

Oncotarget , 2017 Mar 17; 8(18):30288-30304. Epub 2017 Mar 17

PubMed ID: 28415821 DOI: 10.18632/oncotarget.16327

Varzavand A, Hacker W, Ma D, Gibson-Corley K, Hawayek M, Tayh OJ, Brown JA, Henry MD, Stipp CS

α3β1 Integrin suppresses prostate cancer metastasis via regulation of the Hippo pathway

Cancer Res , 2016 Sep 28; 76(22):6577-6587. Epub 2016 Sep 28

PubMed ID: 27680681 DOI: 10.1158/0008-5472.CAN-16-1483

Kurozumi A, Goto Y, Matsushita R, Fukumoto I, Kato M, Nishikawa R, Sakamoto S, Enokida H, Nakagawa M, Ichikawa T, Seki N

Tumor‐suppressive microRNA‐223 inhibits cancer cell migration and invasion by targeting ITGA3/ITGB1 signaling in prostate cancer

Cancer Sci , 2016/01/01; 107(1):84-94. Epub 2015 Dec 5

PubMed ID: 26509963 DOI: 10.1111/cas.12842

Did we miss your publication?

Have you published using HPA008572? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch