Enhanced Validation

Anti-HAO1 Antibody

hydroxyacid oxidase (glycolate oxidase) 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human HAO1
Alternative Gene Names
GOX, GOX1
Price
$437.00
Product Number
HPA049552
Unit Size
100 µl
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Target protein
hydroxyacid oxidase (glycolate oxidase) 1
Target gene
HAO1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000027261 (89%)

Rat ENSRNOG00000004601 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
hydroxyacid oxidase (glycolate oxidase) 1
Gene Name
HAO1
Alternative Gene Names
GOX, GOX1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000101323 on the Human Protein Atlas

Kampf C, Mardinoglu A, Fagerberg L, Hallström BM, Edlund K, Lundberg E, Pontén F, Nielsen J, Uhlen M

The human liver-specific proteome defined by transcriptomics and antibody-based profiling.

FASEB J , 2014 Jul; 28(7):2901-14. Epub 2014 Mar 19

PubMed ID: 24648543 DOI: 10.1096/fj.14-250555

Did we miss your publication?

Have you published using HPA049552? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens