Enhanced Validation

Anti-GUCA2A Antibody

guanylate cyclase activator 2A (guanylin)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human GUCA2A
Alternative Gene Names
GUCA2, STARA
Price
$437.00
Product Number
HPA018215
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
guanylate cyclase activator 2A (guanylin)
Target gene
GUCA2A
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000023247 (65%)

Rat ENSRNOG00000008849 (64%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
guanylate cyclase activator 2A (guanylin)
Gene Name
GUCA2A
Alternative Gene Names
GUCA2, STARA
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000197273 on the Human Protein Atlas

Brenna Ø, Furnes MW, Munkvold B, Kidd M, Sandvik AK, Gustafsson BI

Cellular localization of guanylin and uroguanylin mRNAs in human and rat duodenal and colonic mucosa

Cell Tissue Res , 2016 Apr 5; 365:331-341. Epub 2016 Apr 5

PubMed ID: 27044258 DOI: 10.1007/s00441-016-2393-y

Brenna Ø, Bruland T, Furnes MW, Granlund AV, Drozdov I, Emgård J, Brønstad G, Kidd M, Sandvik AK, Gustafsson BI

The guanylate cyclase-C signaling pathway is down-regulated in inflammatory bowel disease

Scand J Gastroenterol , 2015; 50(10):1241-1252. Epub 2015 May 15

PubMed ID: 25979109 DOI: 10.3109/00365521.2015.1038849

Wilson C, Lin JE, Li P, Snook AE, Gong J, Sato T, Liu C, Girondo MA, Rui H, Hyslop T, Waldman SA

The paracrine hormone for the GUCY2C tumor suppressor, guanylin, is universally lost in colorectal cancer

Cancer Epidemiol Biomarkers Prev , 2014 Nov; 23(11):2328-2337. Epub 2014 Oct 10

PubMed ID: 25304930 DOI: 10.1158/1055-9965.EPI-14-0440

Did we miss your publication?

Have you published using HPA018215? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens