Enhanced Validation

Anti-GOLM1 Antibody

golgi membrane protein 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human GOLM1
Alternative Gene Names
bA379P1.3, C9orf155, FLJ23608, GOLPH2, GP73
Price
$437.00
Product Number
HPA010638
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
golgi membrane protein 1
Target gene
GOLM1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000021556 (46%)

Rat ENSRNOG00000018400 (45%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
golgi membrane protein 1
Gene Name
GOLM1
Alternative Gene Names
bA379P1.3, C9orf155, FLJ23608, GOLPH2, GP73
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000135052 on the Human Protein Atlas

Zhou M, Chen X, Wu J, He X, Ren R

MicroRNA-143 regulates cell migration and invasion by targeting GOLM1 in cervical cancer

Oncol Lett , 2018 Sep 17; 16(5):6393-6400. Epub 2018 Sep 17

PubMed ID: 30405775 DOI: 10.3892/ol.2018.9441

Goto Y, Kojima S, Nishikawa R, Enokida H, Chiyomaru T, Kinoshita T, Nakagawa M, Naya Y, Ichikawa T, Seki N

The microRNA-23b/27b/24-1 cluster is a disease progression marker and tumor suppressor in prostate cancer

Oncotarget , 2014 Sep 15; 5(17):7748-7759. Epub 2014 Jul 31

PubMed ID: 25115396 DOI: 10.18632/oncotarget.2294

Kojima S, Enokida H, Yoshino H, Itesako T, Chiyomaru T, Kinoshita T, Fuse M, Nishikawa R, Goto Y, Naya Y, Nakagawa M, Seki N

The tumor-suppressive microRNA-143/145 cluster inhibits cell migration and invasion by targeting GOLM1 in prostate cancer.

J Hum Genet , 2014 Feb; 59(2):78-87. Epub 2013 Nov 28

PubMed ID: 24284362 DOI: 10.1038/jhg.2013.121

Did we miss your publication?

Have you published using HPA010638? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens