Enhanced Validation

Polyclonal Anti-GFAP Antibody

glial fibrillary acidic protein
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human GFAP
Alternative Gene Names
FLJ45472
Price
$505.00
Product Number
HPA056030
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
glial fibrillary acidic protein
Target Gene
GFAP
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000002919 (100%)

Mouse ENSMUSG00000020932 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-GFAP HPA063513.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
glial fibrillary acidic protein
Gene Name
GFAP
Alternative Gene Names
FLJ45472
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000131095 on the Human Protein Atlas

Xu QQ, Su ZR, Yang W, Zhong M, Xian YF, Lin ZX

Patchouli alcohol attenuates the cognitive deficits in a transgenic mouse model of Alzheimer’s disease via modulating neuropathology and gut microbiota through suppressing C/EBPβ/AEP pathway

J Neuroinflammation , 2023 Jan 30; 20:19. Epub 2023 Jan 30

PubMed ID: 36717922 DOI: 10.1186/s12974-023-02704-1

Provenzano F, Nyberg S, Giunti D, Torazza C, Parodi B, Bonifacino T, Usai C, Kerlero de Rosbo N, Milanese M, Uccelli A, Shaw PJ, Ferraiuolo L, Bonanno G

Micro-RNAs Shuttled by Extracellular Vesicles Secreted from Mesenchymal Stem Cells Dampen Astrocyte Pathological Activation and Support Neuroprotection in In-Vitro Models of ALS

Cells , 2022 Dec 4; 11(23):3923. Epub 2022 Dec 4

PubMed ID: 36497181 DOI: 10.3390/cells11233923

Zou L, Wang J, Fang Y, Tian H

PEG-mediated transduction of rAAV as a platform for spatially confined and efficient gene delivery

Biomater Res , 2022 Dec 2; 26:69. Epub 2022 Dec 2

PubMed ID: 36461117 DOI: 10.1186/s40824-022-00322-1

Takahashi TM, Hirano A, Kanda T, Saito VM, Ashitomi H, Tanaka KZ, Yokoshiki Y, Masuda K, Yanagisawa M, Vogt KE, Tokuda T, Sakurai T

Optogenetic induction of hibernation-like state with modified human Opsin4 in mice

Cell Rep Methods , 2022 Nov 14; 2(11):100336. Epub 2022 Nov 14

PubMed ID: 36452866 DOI: 10.1016/j.crmeth.2022.100336

Jing Y, Bai F, Wang L, Yang D, Yan Y, Wang Q, Zhu Y, Yu Y, Chen Z

Fecal Microbiota Transplantation Exerts Neuroprotective Effects in a Mouse Spinal Cord Injury Model by Modulating the Microenvironment at the Lesion Site

Microbiol Spectr , 2022 Apr 25; 10(3):e00177-22. Epub 2022 Apr 25

PubMed ID: 35467388 DOI: 10.1128/spectrum.00177-22

Privat-Maldonado A, Verloy R, Cardenas Delahoz E, Lin A, Vanlanduit S, Smits E, Bogaerts A

Cold Atmospheric Plasma Does Not Affect Stellate Cells Phenotype in Pancreatic Cancer Tissue in Ovo

Int J Mol Sci , 2022 Feb 10; 23(4):1954. Epub 2022 Feb 10

PubMed ID: 35216069 DOI: 10.3390/ijms23041954

Zummo F, Esposito P, Hou H, Wetzl C, Rius G, Tkatchenko R, Guimera A, Godignon P, Prato M, Prats-Alfonso E, Criado A, Scaini D

Bidirectional Modulation of Neuronal Cells Electrical and Mechanical Properties Through Pristine and Functionalized Graphene Substrates

Front Neurosci , 2022 Jan 11; 15:811348. Epub 2022 Jan 11

PubMed ID: 35087375 DOI: 10.3389/fnins.2021.811348

Zou L, Tian H, Guan S, Ding J, Gao L, Wang J, Fang Y

Self-assembled multifunctional neural probes for precise integration of optogenetics and electrophysiology

Nat Commun , 2021 Oct 7; 12:5871. Epub 2021 Oct 7

PubMed ID: 34620851 DOI: 10.1038/s41467-021-26168-0

Ben Khedher MR, Haddad M, Laurin D, Ramassamy C

Effect of APOE ε4 allele on levels of apolipoproteins E, J, and D, and redox signature in circulating extracellular vesicles from cognitively impaired with no dementia participants converted to Alzheimer's disease

Alzheimers Dement (Amst) , 2021 Sep 14; 13(1):e12231. Epub 2021 Sep 14

PubMed ID: 34541286 DOI: 10.1002/dad2.12231

Banerjee S, Ghoshal S, Girardet C, DeMars KM, Yang C, Niehoff ML, Nguyen AD, Jayanth P, Hoelscher BA, Xu F, Banks WA, Hansen KM, Zhang J, Candelario-Jalil E, Farr SA, Butler AA

Adropin correlates with aging-related neuropathology in humans and improves cognitive function in aging mice

NPJ Aging Mech Dis , 2021 Aug 30; 7:23. Epub 2021 Aug 30

PubMed ID: 34462439 DOI: 10.1038/s41514-021-00076-5

Seguella L, Pesce M, Capuano R, Casano F, Pesce M, Corpetti C, Vincenzi M, Maftei D, Lattanzi R, Del Re A, Sarnelli G, Gulbransen BD, Esposito G

High-fat diet impairs duodenal barrier function and elicits glia-dependent changes along the gut-brain axis that are required for anxiogenic and depressive-like behaviors

J Neuroinflammation , 2021 May 16; 18:115. Epub 2021 May 16

PubMed ID: 33993886 DOI: 10.1186/s12974-021-02164-5

Qu C, Li QP, Su ZR, Ip SP, Yuan QJ, Xie YL, Xu QQ, Yang W, Huang YF, Xian YF, Lin ZX

Nano-Honokiol ameliorates the cognitive deficits in TgCRND8 mice of Alzheimer’s disease via inhibiting neuropathology and modulating gut microbiota

J Adv Res , 2021 Mar 31; 35:231-243. Epub 2021 Mar 31

PubMed ID: 35024199 DOI: 10.1016/j.jare.2021.03.012

Prpar Mihevc S, Zakošek Pipan M, Štrbenc M, Rogelj B, Majdič G

Nitrosative Stress in the Frontal Cortex From Dogs With Canine Cognitive Dysfunction

Front Vet Sci , 2020 Nov 19; 7:573155. Epub 2020 Nov 19

PubMed ID: 33330694 DOI: 10.3389/fvets.2020.573155

Yang W, Liu Y, Xu QQ, Xian YF, Lin ZX

Sulforaphene Ameliorates Neuroinflammation and Hyperphosphorylated Tau Protein via Regulating the PI3K/Akt/GSK-3β Pathway in Experimental Models of Alzheimer's Disease

Oxid Med Cell Longev , 2020 Sep 10; 2020:4754195. Epub 2020 Sep 10

PubMed ID: 32963694 DOI: 10.1155/2020/4754195

Gao ML, Lei XL, Han F, He KW, Jin SQ, Zhang YY, Jin ZB

Patient-Specific Retinal Organoids Recapitulate Disease Features of Late-Onset Retinitis Pigmentosa

Front Cell Dev Biol , 2020 Mar 6; 8:128. Epub 2020 Mar 6

PubMed ID: 32211407 DOI: 10.3389/fcell.2020.00128

Anstötz M, Maccaferri G

A Toolbox of Criteria for Distinguishing Cajal–Retzius Cells from Other Neuronal Types in the Postnatal Mouse Hippocampus

eNeuro , 2020 Jan 22; 7(1):ENEURO.0516-19.2019. Epub 2020 Jan 22

PubMed ID: 31907212 DOI: 10.1523/ENEURO.0516-19.2019

Sun Z, Xu X, He J, Murray A, Sun MA, Wei X, Wang X, McCoig E, Xie E, Jiang X, Li L, Zhu J, Chen J, Morozov A, Pickrell AM, Theus MH, Xie H

EGR1 recruits TET1 to shape the brain methylome during development and upon neuronal activity

Nat Commun , 2019 Aug 29; 10:3892. Epub 2019 Aug 29

PubMed ID: 31467272 DOI: 10.1038/s41467-019-11905-3

Bedri SK, Nilsson OB, Fink K, Månberg A, Hamsten C, Ayoglu B, Manouchehrinia A, Nilsson P, Olsson T, Hillert J, Grönlund H, Glaser A

Plasma protein profiling reveals candidate biomarkers for multiple sclerosis treatment

PLoS One , 2019 May 29; 14(5):e0217208. Epub 2019 May 29

PubMed ID: 31141529 DOI: 10.1371/journal.pone.0217208

Yu X, Wang X, Zeng S, Tuo X

Protective effects of primary neural stem cell treatment in ischemic stroke models

Exp Ther Med , 2018 Jul 18; 16(3):2219-2228. Epub 2018 Jul 18

PubMed ID: 30186461 DOI: 10.3892/etm.2018.6466

Wu XP, She RX, Yang YP, Xing ZM, Chen HW, Zhang YW

MicroRNA-365 alleviates morphine analgesic tolerance via the inactivation of the ERK/CREB signaling pathway by negatively targeting β-arrestin2

J Biomed Sci , 2018 Feb 7; 25:10. Epub 2018 Feb 7

PubMed ID: 29415719 DOI: 10.1186/s12929-018-0405-9

Yang B, Yang C, Fang J, Yang J, Xu Y

Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases

Oncol Lett , 2017 Jul 20; 14(3):3825-3831. Epub 2017 Jul 20

PubMed ID: 28927153 DOI: 10.3892/ol.2017.6620

Did we miss your publication?

Have you published using HPA056030? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch