Anti-ESYT3 Antibody

extended synaptotagmin-like protein 3
Recommended Applications
Product Description
Polyclonal Antibody against Human ESYT3
Alternative Gene Names
CHR3SYT, FAM62C
Price
$445.00
Product Number
HPA039200
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
extended synaptotagmin-like protein 3
Target Gene
ESYT3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PYADLTLEQRFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000037681 (76%)

Rat ENSRNOG00000022704 (72%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Protein Name
extended synaptotagmin-like protein 3
Gene Name
ESYT3
Alternative Gene Names
CHR3SYT, FAM62C
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000158220 on the Human Protein Atlas

Fernández-Busnadiego R, Saheki Y, De Camilli P

Three-dimensional architecture of extended synaptotagmin-mediated endoplasmic reticulum–plasma membrane contact sites

Proc Natl Acad Sci U S A , 2015 Apr 21; 112(16):E2004-E2013. Epub 2015 Mar 18

PubMed ID: 25787254 DOI: 10.1073/pnas.1503191112

Did we miss your publication?

Have you published using HPA039200? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch