Enhanced Validation

Polyclonal Anti-ESR1 Antibody

estrogen receptor 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ESR1
Alternative Gene Names
Era, ESR, NR3A1
Price
$505.00
Product Number
HPA000449
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
estrogen receptor 1
Target Gene
ESR1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000019768 (88%)

Rat ENSRNOG00000019358 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-ESR1 HPA000450.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
estrogen receptor 1
Gene Name
ESR1
Alternative Gene Names
Era, ESR, NR3A1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000091831 on the Human Protein Atlas

Balcazar Lopez CE, Albrecht J, Hafstað V, Börjesson Freitag C, Vallon‐Christersson J, Bellodi C, Persson H

Alternative promoters and splicing create multiple functionally distinct isoforms of oestrogen receptor alpha in breast cancer and healthy tissues

Cancer Med , 2023 Sep 7; 12(18):18931-18945. Epub 2023 Sep 7

PubMed ID: 37676103 DOI: 10.1002/cam4.6508

Ye L, Lin C, Wang X, Li Q, Li Y, Wang M, Zhao Z, Wu X, Shi D, Xiao Y, Ren L, Jian Y, Yang M, Ou R, Deng G, Ouyang Y, Chen X, Li J, Song L

Epigenetic silencing of SALL2 confers tamoxifen resistance in breast cancer

EMBO Mol Med , 2019 Oct 28; 11(12):e10638. Epub 2019 Oct 28

PubMed ID: 31657150 DOI: 10.15252/emmm.201910638

Scalia CR, Boi G, Bolognesi MM, Riva L, Manzoni M, DeSmedt L, Bosisio FM, Ronchi S, Leone BE, Cattoretti G

Antigen Masking During Fixation and Embedding, Dissected

J Histochem Cytochem , 2016 Oct 20; 65(1):5-20. Epub 2016 Oct 20

PubMed ID: 27798289 DOI: 10.1369/0022155416673995

Algenäs C, Agaton C, Fagerberg L, Asplund A, Björling L, Björling E, Kampf C, Lundberg E, Nilsson P, Persson A, Wester K, Pontén F, Wernérus H, Uhlén M, Ottosson Takanen J, Hober S

Antibody performance in western blot applications is context-dependent.

Biotechnol J , 2014 Mar; 9(3):435-45. Epub 2014 Jan 29

PubMed ID: 24403002 DOI: 10.1002/biot.201300341

Did we miss your publication?

Have you published using HPA000449? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch