Enhanced Validation

Polyclonal Anti-ESR1 Antibody

estrogen receptor 1
References (4)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ESR1
Alternative Gene Names
Era, ESR, NR3A1
Open Datasheet
Price
$505.00
Product Number
HPA000449
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[6 pictures]
Immunohistochemistry analysis in human endometrium and cerebral cortex tissues using HPA000449 antibody. Corresponding ESR1 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ESR1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & vesicles.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
estrogen receptor 1
Target Gene
ESR1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000019768 (88%)

Rat ENSRNOG00000019358 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-ESR1 HPA000450.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA000449 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA000449 on the Human Protein Atlas
Protein Name
estrogen receptor 1
Gene Name
ESR1
Alternative Gene Names
Era, ESR, NR3A1
UniProt ID
P03372
Gene (Ensembl)
ENSG00000091831
Entrez Gene ID
Entrez gene: 2099
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000091831 on the Human Protein Atlas

Ye L, Lin C, Wang X, Li Q, Li Y, Wang M, Zhao Z, Wu X, Shi D, Xiao Y, Ren L, Jian Y, Yang M, Ou R, Deng G, Ouyang Y, Chen X, Li J, Song L

Epigenetic silencing of SALL2 confers tamoxifen resistance in breast cancer

EMBO Mol Med , 2019 Oct 28; 11(12):e10638. Epub 2019 Oct 28

PubMed ID: 31657150 DOI: 10.15252/emmm.201910638

Scalia CR, Boi G, Bolognesi MM, Riva L, Manzoni M, DeSmedt L, Bosisio FM, Ronchi S, Leone BE, Cattoretti G

Antigen Masking During Fixation and Embedding, Dissected

J Histochem Cytochem , 2016 Oct 20; 65(1):5-20. Epub 2016 Oct 20

PubMed ID: 27798289 DOI: 10.1369/0022155416673995

Algenäs C, Agaton C, Fagerberg L, Asplund A, Björling L, Björling E, Kampf C, Lundberg E, Nilsson P, Persson A, Wester K, Pontén F, Wernérus H, Uhlén M, Ottosson Takanen J, Hober S

Antibody performance in western blot applications is context-dependent.

Biotechnol J , 2014 Mar; 9(3):435-45. Epub 2014 Jan 29

PubMed ID: 24403002 DOI: 10.1002/biot.201300341

Did we miss your publication?

Have you published using HPA000449? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-ESR1 (AMAb90867)
Anti-ESR1 (HPA000450)
Corresponding Antigens
PrEST Antigen ESR1 (APrEST79702)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch