Enhanced Validation

Anti-EGFR Antibody

epidermal growth factor receptor
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human EGFR
Alternative Gene Names
ERBB, ERBB1
Price
$437.00
Product Number
HPA018530
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
epidermal growth factor receptor
Target gene
EGFR
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000020122 (84%)

Rat ENSRNOG00000004332 (82%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
epidermal growth factor receptor
Gene Name
EGFR
Alternative Gene Names
ERBB, ERBB1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000146648 on the Human Protein Atlas

Gupta MK, Polisetty RV, Sharma R, Ganesh RA, Gowda H, Purohit AK, Ankathi P, Prasad K, Mariswamappa K, Lakshmikantha A, Uppin MS, Sundaram C, Gautam P, Sirdeshmukh R

Altered transcriptional regulatory proteins in glioblastoma and YBX1 as a potential regulator of tumor invasion

Sci Rep , 2019 Jul 29; 9:10986. Epub 2019 Jul 29

PubMed ID: 31358880 DOI: 10.1038/s41598-019-47360-9

Huang LC, Tam KW, Liu WN, Lin CY, Hsu KW, Hsieh WS, Chi WM, Lee AW, Yang JM, Lin CL, Lee CH

CRISPR/Cas9 Genome Editing of Epidermal Growth Factor Receptor Sufficiently Abolished Oncogenicity in Anaplastic Thyroid Cancer

Dis Markers , 2018 Apr 12; 2018:3835783. Epub 2018 Apr 12

PubMed ID: 29849821 DOI: 10.1155/2018/3835783

Wymant JM, Hiscox S, Westwell AD, Urbé S, Clague MJ, Jones AT

The Role of BCA2 in the Endocytic Trafficking of EGFR and Significance as a Prognostic Biomarker in Cancer

J Cancer , 2016 Dec 9; 7(15):2388-2407. Epub 2016 Dec 9

PubMed ID: 27994678 DOI: 10.7150/jca.15055

Galardi S, Savino M, Scagnoli F, Pellegatta S, Pisati F, Zambelli F, Illi B, Annibali D, Beji S, Orecchini E, Alberelli MA, Apicella C, Fontanella RA, Michienzi A, Finocchiaro G, Farace MG, Pavesi G, Ciafrè SA, Nasi S

Resetting cancer stem cell regulatory nodes upon MYC inhibition

EMBO Rep , 2016 Nov 16; 17(12):1872-1889. Epub 2016 Nov 16

PubMed ID: 27852622 DOI: 10.15252/embr.201541489

Polisetty RV, Gautam P, Gupta MK, Sharma R, Gowda H, Renu D, Shivakumar BM, Lakshmikantha A, Mariswamappa K, Ankathi P, Purohit AK, Uppin MS, Sundaram C, Sirdeshmukh R

Microsomal membrane proteome of low grade diffuse astrocytomas: Differentially expressed proteins and candidate surveillance biomarkers

Sci Rep , 2016 Jun 1; 6:26882. Epub 2016 Jun 1

PubMed ID: 27246909 DOI: 10.1038/srep26882

Luke GP, Myers JN, Emelianov SY, Sokolov KV

Sentinel lymph node biopsy revisited: ultrasound-guided photoacoustic detection of micrometastases using molecularly targeted plasmonic nanosensors

Cancer Res , 2014 Oct 1; 74(19):5397-5408. Epub 2014 Aug 8

PubMed ID: 25106426 DOI: 10.1158/0008-5472.CAN-14-0796

Arabi A, Ullah K, Branca RM, Johansson J, Bandarra D, Haneklaus M, Fu J, Ariës I, Nilsson P, Den Boer ML, Pokrovskaja K, Grandér D, Xiao G, Rocha S, Lehtiö J, Sangfelt O

Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway.

Nat Commun , 2012; 3:976

PubMed ID: 22864569 DOI: 10.1038/ncomms1975

Did we miss your publication?

Have you published using HPA018530? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch