Enhanced Validation

Anti-DHX37 Antibody

DEAH (Asp-Glu-Ala-His) box polypeptide 37
References (2)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human DHX37
Alternative Gene Names
DDX37, KIAA1517, MGC2695, MGC4322
Open Datasheet
Price
$450.00
Product Number
HPA047607
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Show all images
[5 pictures]
Immunohistochemistry analysis in human skin and liver tissues using HPA047607 antibody. Corresponding DHX37 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line MCF7 shows localization to nuclear membrane.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
DEAH (Asp-Glu-Ala-His) box polypeptide 37
Target Gene
DHX37
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVNAVCPEAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000022171 (87%)

Mouse ENSMUSG00000029480 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA047607 on the Human Protein Atlas
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA047607 on the Human Protein Atlas
Protein Name
DEAH (Asp-Glu-Ala-His) box polypeptide 37
Gene Name
DHX37
Alternative Gene Names
DDX37, KIAA1517, MGC2695, MGC4322
UniProt ID
Q8IY37
Gene (Ensembl)
ENSG00000150990
Entrez Gene ID
Entrez gene: 57647
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000150990 on the Human Protein Atlas

McElreavey K, Jorgensen A, Eozenou C, Merel T, Bignon-Topalovic J, Tan DS, Houzelstein D, Buonocore F, Warr N, Kay RG, Peycelon M, Siffroi JP, Mazen I, Achermann JC, Shcherbak Y, Leger J, Sallai A, Carel JC, Martinerie L, Le Ru R, Conway GS, Mignot B, Van Maldergem L, Bertalan R, Globa E, Brauner R, Jauch R, Nef S, Greenfield A, Bashamboo A

Pathogenic variants in the DEAH-box RNA helicase DHX37 are a frequent cause of 46,XY gonadal dysgenesis and 46,XY testicular regression syndrome

Genet Med , 2019 Jul 24; 22(1):150-159. Epub 2019 Jul 24

PubMed ID: 31337883 DOI: 10.1038/s41436-019-0606-y

Did we miss your publication?

Have you published using HPA047607? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens
PrEST Antigen DHX37 (APrEST81112)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch