Anti-DACH1 Antibody

dachshund family transcription factor 1
Recommended Applications
Product Description
Polyclonal Antibody against Human DACH1
Alternative Gene Names
DACH
Price
$445.00
Product Number
HPA012672
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
dachshund family transcription factor 1
Target Gene
DACH1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000055639 (91%)

Rat ENSRNOG00000008834 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
dachshund family transcription factor 1
Gene Name
DACH1
Alternative Gene Names
DACH
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000276644 on the Human Protein Atlas

Zhou J, Shaikh LH, Neogi SG, McFarlane I, Zhao W, Figg N, Brighton CA, Maniero C, Teo AE, Azizan EA, Brown MJ

DACH1, a Zona Glomerulosa Selective Gene in the Human Adrenal, Activates Transforming Growth Factor-β Signaling and Suppresses Aldosterone Secretion

Hypertension , 2015 May; 65(5):1103-1110. Epub 2015 Apr 8

PubMed ID: 25776071 DOI: 10.1161/HYP.0000000000000025

Powe DG, Dhondalay GK, Lemetre C, Allen T, Habashy HO, Ellis IO, Rees R, Ball GR

DACH1: Its Role as a Classifier of Long Term Good Prognosis in Luminal Breast Cancer

PLoS One , 2014; 9(1):e84428. Epub 2014 Jan 2

PubMed ID: 24392136 DOI: 10.1371/journal.pone.0084428

Vonlanthen J, Okoniewski MJ, Menigatti M, Cattaneo E, Pellegrini-Ochsner D, Haider R, Jiricny J, Staiano T, Buffoli F, Marra G

A comprehensive look at transcription factor gene expression changes in colorectal adenomas

BMC Cancer , 2014 Jan 29; 14:46. Epub 2014 Jan 29

PubMed ID: 24472434 DOI: 10.1186/1471-2407-14-46

Did we miss your publication?

Have you published using HPA012672? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch