Anti-CXADR Antibody

coxsackie virus and adenovirus receptor
Recommended Applications
Product Description
Polyclonal Antibody against Human CXADR
Alternative Gene Names
CAR
Price
$445.00
Product Number
HPA003342
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
coxsackie virus and adenovirus receptor
Target Gene
CXADR
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000022865 (91%)

Rat ENSRNOG00000001557 (89%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
coxsackie virus and adenovirus receptor
Gene Name
CXADR
Alternative Gene Names
CAR
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000154639 on the Human Protein Atlas

Kawada M, Inoue H, Kajikawa M, Sugiura M, Sakamoto S, Urano S, Karasawa C, Usami I, Futakuchi M, Masuda T

A novel monoclonal antibody targeting coxsackie virus and adenovirus receptor inhibits tumor growth in vivo

Sci Rep , 2017 Jan 11; 7:40400. Epub 2017 Jan 11

PubMed ID: 28074864 DOI: 10.1038/srep40400

Zussy C, Loustalot F, Junyent F, Gardoni F, Bories C, Valero J, Desarménien MG, Bernex F, Henaff D, Bayo-Puxan N, Chen JW, Lonjon N, de Koninck Y, Malva JO, Bergelson JM, di Luca M, Schiavo G, Salinas S, Kremer EJ

Coxsackievirus Adenovirus Receptor Loss Impairs Adult Neurogenesis, Synapse Content, and Hippocampus Plasticity

J Neurosci , 2016 Sep 14; 36(37):9558-9571

PubMed ID: 27629708 DOI: 10.1523/JNEUROSCI.0132-16.2016

Kwon J, Jeong SM, Choi I, Kim NH

ADAM10 Is Involved in Cell Junction Assembly in Early Porcine Embryo Development

PLoS One , 2016 Apr 4; 11(4):e0152921. Epub 2016 Apr 4

PubMed ID: 27043020 DOI: 10.1371/journal.pone.0152921

Vincent T, Neve EP, Johnson JR, Kukalev A, Rojo F, Albanell J, Pietras K, Virtanen I, Philipson L, Leopold PL, Crystal RG, de Herreros AG, Moustakas A, Pettersson RF, Fuxe J

A SNAIL1-SMAD3/4 transcriptional repressor complex promotes TGF-beta mediated epithelial-mesenchymal transition.

Nat Cell Biol , 2009 Aug; 11(8):943-50. Epub 2009 Jul 13

PubMed ID: 19597490 DOI: 10.1038/ncb1905

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Did we miss your publication?

Have you published using HPA003342? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch