Enhanced Validation

Anti-COL6A2 Antibody

collagen, type VI, alpha 2
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human COL6A2
Price
$445.00
Product Number
HPA007029
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
collagen, type VI, alpha 2
Target Gene
COL6A2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALANMTEQIRQDR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000020241 (89%)

Rat ENSRNOG00000001254 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibodies Anti-COL6A2 HPA030920, Anti-COL6A2 HPA038799.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
collagen, type VI, alpha 2
Gene Name
COL6A2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000142173 on the Human Protein Atlas

Ghosh Z, Huang M, Hu S, Wilson KD, Dey D, Wu JC

Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells.

Cancer Res , 2011 Jul 15; 71(14):5030-9. Epub 2011 Jun 6

PubMed ID: 21646469 DOI: 10.1158/0008-5472.CAN-10-4402

Liu Y, Carson-Walter EB, Cooper A, Winans BN, Johnson MD, Walter KA

Vascular gene expression patterns are conserved in primary and metastatic brain tumors

J Neurooncol , 2010 Aug; 99(1):13-24. Epub 2010 Jan 9

PubMed ID: 20063114 DOI: 10.1007/s11060-009-0105-0

Did we miss your publication?

Have you published using HPA007029? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch