Enhanced Validation

Anti-CISD2 Antibody

CDGSH iron sulfur domain 2
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human CISD2
Alternative Gene Names
ERIS, Miner1, NAF-1, WFS2, ZCD2
Price
$437.00
Product Number
HPA015914
Unit Size
100 µl
Concentration
Lot dependent
Availability
7 in Stock
Ships
Ready to Ship
Target protein
CDGSH iron sulfur domain 2
Target gene
CISD2
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000028165 (100%)

Rat ENSRNOG00000048258 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
CDGSH iron sulfur domain 2
Gene Name
CISD2
Alternative Gene Names
ERIS, Miner1, NAF-1, WFS2, ZCD2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000145354 on the Human Protein Atlas

Li SM, Chen CH, Chen YW, Yen YC, Fang WT, Tsai FY, Chang JL, Shen YY, Huang SF, Chuu CP, Chang IS, Hsiung CA, Jiang SS

Upregulation of CISD2 augments ROS homeostasis and contributes to tumorigenesis and poor prognosis of lung adenocarcinoma

Sci Rep , 2017 Sep 19; 7:11893. Epub 2017 Sep 19

PubMed ID: 28928421 DOI: 10.1038/s41598-017-12131-x

Darash-Yahana M, Pozniak Y, Lu M, Sohn YS, Karmi O, Tamir S, Bai F, Song L, Jennings PA, Pikarsky E, Geiger T, Onuchic JN, Mittler R, Nechushtai R

Breast cancer tumorigenicity is dependent on high expression levels of NAF-1 and the lability of its Fe-S clusters

Proc Natl Acad Sci U S A , 2016 Sep 12; 113(39):10890-10895. Epub 2016 Sep 12

PubMed ID: 27621439 DOI: 10.1073/pnas.1612736113

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Did we miss your publication?

Have you published using HPA015914? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch