1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-CFB

Anti-CFB Antibody

complement factor B
References (3)
Recommended Applications
Product Description
Polyclonal Antibody against Human CFB
Alternative Gene Names
BF, BFD, H2-Bf
Open Datasheet
Price
$450.00
Product Number
HPA001832
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
complement factor B
Target Gene
CFB
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000000419 (87%)

Mouse ENSMUSG00000090231 (86%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
complement factor B
Gene Name
CFB
Alternative Gene Names
BF, BFD, H2-Bf
UniProt ID
P00751
Gene (Ensembl)
ENSG00000243649
Entrez Gene ID
Entrez gene: 629
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000243649 on the Human Protein Atlas

Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM

Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model

Proteome Sci , 2011 Nov 17; 9:73. Epub 2011 Nov 17

PubMed ID: 22093360 DOI: 10.1186/1477-5956-9-73

Singh MV, Kapoun A, Higgins L, Kutschke W, Thurman JM, Zhang R, Singh M, Yang J, Guan X, Lowe JS, Weiss RM, Zimmermann K, Yull FE, Blackwell TS, Mohler PJ, Anderson ME

Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart.

J Clin Invest , 2009 Apr; 119(4):986-96. Epub 2009 Mar 9

PubMed ID: 19273909 DOI: 10.1172/JCI35814

Did we miss your publication?

Have you published using HPA001832? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-CFB (HPA000951)
Anti-CFB (HPA001817)
Corresponding Antigens
PrEST Antigen CFB (APrEST84375)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-CFB