Enhanced Validation

Polyclonal Anti-CDK1 Antibody

cyclin-dependent kinase 1
References (11)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CDK1
Alternative Gene Names
CDC2, CDC28A
Open Datasheet
Price
$505.00
Product Number
HPA003387
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA003387 antibody. Corresponding CDK1 RNA-seq data are presented for the same tissues.
Show all images
[2 pictures]
Western blot analysis in human cell line A-431.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
cyclin-dependent kinase 1
Target Gene
CDK1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000019942 (98%)

Rat ENSRNOG00000000632 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA003387 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA003387 on the Human Protein Atlas
Protein Name
cyclin-dependent kinase 1
Gene Name
CDK1
Alternative Gene Names
CDC2, CDC28A
UniProt ID
P06493
Gene (Ensembl)
ENSG00000170312
Entrez Gene ID
Entrez gene: 983
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000170312 on the Human Protein Atlas

Gražvydas Lukinavičius, Darja Lavogina, Pierre Gönczy, Kai Johnsson

Commercial Cdk1 antibodies recognize the centrosomal protein Cep152

BioTechniques , September 2013; 55(3):111-114

PubMed ID: 24137814 DOI: doi 10.2144/000114074

Suski JM, Ratnayeke NJ, Braun M, Zhang T, Strmiska V, Michowski W, Can G, Simoneau A, Snioch K, Cup M, Sullivan CM, Wu X, Nowacka J, Branigan TB, Pack LR, DeCaprio JA, Geng Y, Zou L, Gygi SP, Walter JC, Meyer T, Sicinski P

Cdc7-independent G1/S transition revealed by targeted protein degradation

Nature , 2022 May 4; 605(7909):357-365. Epub 2022 May 4

PubMed ID: 35508654 DOI: 10.1038/s41586-022-04698-x

Shen P, He X, Lan L, Hong Y, Lin M

Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis

Biosci Rep , 2020 Jul 27; 40(7):BSR20194429. Epub 2020 Jul 27

PubMed ID: 32677673 DOI: 10.1042/BSR20194429

Yasukawa M, Ando Y, Yamashita T, Matsuda Y, Shoji S, Morioka MS, Kawaji H, Shiozawa K, Machitani M, Abe T, Yamada S, Kaneko MK, Kato Y, Furuta Y, Kondo T, Shirouzu M, Hayashizaki Y, Kaneko S, Masutomi K

CDK1 dependent phosphorylation of hTERT contributes to cancer progression

Nat Commun , 2020 Mar 25; 11:1557. Epub 2020 Mar 25

PubMed ID: 32214089 DOI: 10.1038/s41467-020-15289-7

Zheng HP, Huang ZG, He RQ, Lu HP, Dang YW, Lin P, Wen DY, Qin YY, Luo B, Li XJ, Mo WJ, Yang H, He Y, Chen G

Integrated assessment of CDK1 upregulation in thyroid cancer

Am J Transl Res , 2019 Dec 15; 11(12):7233-7254. Epub 2019 Dec 15

PubMed ID: 31934275

Marlier Q, Jibassia F, Verteneuil S, Linden J, Kaldis P, Meijer L, Nguyen L, Vandenbosch R, Malgrange B

Genetic and pharmacological inhibition of Cdk1 provides neuroprotection towards ischemic neuronal death

Cell Death Discov , 2018 Mar 16; 4:43. Epub 2018 Mar 16

PubMed ID: 29581894 DOI: 10.1038/s41420-018-0044-7

Goto Y, Kurozumi A, Arai T, Nohata N, Kojima S, Okato A, Kato M, Yamazaki K, Ishida Y, Naya Y, Ichikawa T, Seki N

Impact of novel miR-145-3p regulatory networks on survival in patients with castration-resistant prostate cancer

Br J Cancer , 2017 Jun 22; 117(3):409-420. Epub 2017 Jun 22

PubMed ID: 28641312 DOI: 10.1038/bjc.2017.191

Müllers E, Silva Cascales H, Burdova K, Macurek L, Lindqvist A

Residual Cdk1/2 activity after DNA damage promotes senescence

Aging Cell , 2017 Mar 26; 16(3):575-584. Epub 2017 Mar 26

PubMed ID: 28345297 DOI: 10.1111/acel.12588

Xu G, Pattamatta A, Hildago R, Pace MC, Brown H, Borchelt DR

Vulnerability of newly synthesized proteins to proteostasis stress

J Cell Sci , 2016 May 1; 129(9):1892-1901

PubMed ID: 27026526 DOI: 10.1242/jcs.176479

Sousa MM, Zub KA, Aas PA, Hanssen-Bauer A, Demirovic A, Sarno A, Tian E, Liabakk NB, Slupphaug G

An Inverse Switch in DNA Base Excision and Strand Break Repair Contributes to Melphalan Resistance in Multiple Myeloma Cells

PLoS One , 2013; 8(2):e55493. Epub 2013 Feb 6

PubMed ID: 23405159 DOI: 10.1371/journal.pone.0055493

Did we miss your publication?

Have you published using HPA003387? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen CDK1 (APrEST86431)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch