Enhanced Validation

Polyclonal Anti-CDH1 Antibody

cadherin 1, type 1, E-cadherin (epithelial)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CDH1
Alternative Gene Names
CD324, UVO, uvomorulin
Price
$505.00
Product Number
HPA004812
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
cadherin 1, type 1, E-cadherin (epithelial)
Target Gene
CDH1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020151 (80%)

Mouse ENSMUSG00000000303 (76%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
cadherin 1, type 1, E-cadherin (epithelial)
Gene Name
CDH1
Alternative Gene Names
CD324, UVO, uvomorulin
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000039068 on the Human Protein Atlas

Meloni M, Buratti P, Carriero F, Ceriotti L

In Vitro Modelling of Barrier Impairment Associated with Gastro-Oesophageal Reflux Disease (GERD)

Clin Exp Gastroenterol , 2021 Sep 8; 14:361-373. Epub 2021 Sep 8

PubMed ID: 34526798 DOI: 10.2147/CEG.S325346

Gao F, Tian J

FOXK1, Regulated by miR-365-3p, Promotes Cell Growth and EMT Indicates Unfavorable Prognosis in Breast Cancer

Onco Targets Ther , 2020 Jan 21; 13:623-634. Epub 2020 Jan 21

PubMed ID: 32021304 DOI: 10.2147/OTT.S212702

Xiong Y, Hu L, Zhang T, Wang M, Xu H, Li TC, Sun Y, Wang CC

Effects of high progesterone in in-vitro fertilization cycle on DNA methylation and gene expression of adhesion molecules on endometrium during implantation window

J Assist Reprod Genet , 2019 Nov 22; 37(1):33-43. Epub 2019 Nov 22

PubMed ID: 31758513 DOI: 10.1007/s10815-019-01623-6

Månberg A, Bradley F, Qundos U, Guthrie BL, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener AD, Nilsson P, Broliden K

A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection

Mol Cell Proteomics , 2019 Mar; 18(3):461-476

PubMed ID: 30504243 DOI: 10.1074/mcp.RA118.000757

Sannigrahi MK, Srinivas CS, Deokate N, Rakshit S

The strong propensity of Cadherin‐23 for aggregation inhibits cell migration

Mol Oncol , 2019 Mar 19; 13(5):1092-1109. Epub 2019 Mar 19

PubMed ID: 30747484 DOI: 10.1002/1878-0261.12469

Kawamura E, Hamilton GB, Miskiewicz EI, MacPhee DJ

Fermitin family homolog-2 (FERMT2) is highly expressed in human placental villi and modulates trophoblast invasion

BMC Dev Biol , 2018 Nov 1; 18:19. Epub 2018 Nov 1

PubMed ID: 30382829 DOI: 10.1186/s12861-018-0178-0

Bajikar SS, Wang CC, Borten MA, Pereira EJ, Atkins KA, Janes KA

Tumor Suppressor Inactivation of GDF11 Occurs by Precursor Sequestration in Triple-Negative Breast Cancer

Dev Cell , 2017 Nov 20; 43(4):418-435.e13

PubMed ID: 29161592 DOI: 10.1016/j.devcel.2017.10.027

Did we miss your publication?

Have you published using HPA004812? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch