Enhanced Validation

Anti-CD200 Antibody

CD200 molecule
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CD200
Alternative Gene Names
MOX1, MOX2, MRC, OX-2
Price
$445.00
Product Number
HPA031149
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
CD200 molecule
Target Gene
CD200
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000022661 (76%)

Rat ENSRNOG00000002141 (73%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
CD200 molecule
Gene Name
CD200
Alternative Gene Names
MOX1, MOX2, MRC, OX-2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000091972 on the Human Protein Atlas

Fukazawa Y, Lum R, Okoye AA, Park H, Matsuda K, Bae JY, Hagen SI, Shoemaker R, Deleage C, Lucero C, Morcock D, Swanson T, Legasse AW, Axthelm MK, Hesselgesser J, Geleziunas R, Hirsch VM, Edlefsen PT, Piatak M Jr, Estes JD, Lifson JD, Picker LJ

A B cell follicle sanctuary permits persistent productive SIV infection in elite controllers

Nat Med , 2015 Feb; 21(2):132-139. Epub 2015 Jan 19

PubMed ID: 25599132 DOI: 10.1038/nm.3781

Yoshinori Fukazawa, Richard Lum, Afam A Okoye, Haesun Park, Kenta Matsuda, Jin Young Bae, Shoko I Hagen, Rebecca Shoemaker, Claire Deleage, Carissa Lucero, David Morcock, Tonya Swanson, Alfred W Legasse, Michael K Axthelm, Joseph Hesselgesser, Romas Geleziunas, Vanessa M Hirsch, Paul T Edlefsen, Michael Piatak Jr, Jacob D Estes, Jeffrey D Lifson, Louis J Picker

B cell follicle sanctuary permits persistent productive simian immunodeficiency virus infection in elite controllers

Nature Medicine , January 19, 2015

PubMed ID: 0 DOI: 10.1038/nm.3781

Did we miss your publication?

Have you published using HPA031149? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch