Enhanced Validation

Polyclonal Anti-CALB2 Antibody

calbindin 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human CALB2
Alternative Gene Names
CAL2
Price
$505.00
Product Number
HPA007305
Unit Size
Concentration
Lot dependent
Availability
9 in Stock
Ships
Ready to Ship
Target Protein
calbindin 2
Target Gene
CALB2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000003657 (98%)

Rat ENSRNOG00000016977 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:5000 - 1:10000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-CALB2 HPA007306.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
calbindin 2
Gene Name
CALB2
Alternative Gene Names
CAL2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000172137 on the Human Protein Atlas

Malacrida B, Nichols S, Maniati E, Jones R, Delanie-Smith R, Roozitalab R, Tyler EJ, Thomas M, Boot G, Mackerodt J, Lockley M, Knight MM, Balkwill FR, Pearce OM

A human multi-cellular model shows how platelets drive production of diseased extracellular matrix and tissue invasion

iScience , 2021 May 29; 24(6):102676. Epub 2021 May 29

PubMed ID: 34189439 DOI: 10.1016/j.isci.2021.102676

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Did we miss your publication?

Have you published using HPA007305? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch