Anti-BRD4 Antibody

bromodomain containing 4
Recommended Applications
Product Description
Polyclonal Antibody against Human BRD4
Alternative Gene Names
CAP, HUNK1, HUNKI, MCAP
Price
$445.00
Product Number
HPA015055
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
bromodomain containing 4
Target Gene
BRD4
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000006770 (94%)

Mouse ENSMUSG00000024002 (76%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
bromodomain containing 4
Gene Name
BRD4
Alternative Gene Names
CAP, HUNK1, HUNKI, MCAP
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000141867 on the Human Protein Atlas

Lu R, Wang J, Ren Z, Yin J, Wang Y, Cai L, Greg Wang G

A model system for studying the DNMT3A hotspot mutation (DNMT3AR882) demonstrates a causal relationship between its dominant-negative effect and leukemogenesis

Cancer Res , 2019 Jun 4; 79(14):3583-3594. Epub 2019 Jun 4

PubMed ID: 31164355 DOI: 10.1158/0008-5472.CAN-18-3275

Shah N, Wang P, Wongvipat J, Karthaus WR, Abida W, Armenia J, Rockowitz S, Drier Y, Bernstein BE, Long HW, Freedman ML, Arora VK, Zheng D, Sawyers CL

Regulation of the glucocorticoid receptor via a BET-dependent enhancer drives antiandrogen resistance in prostate cancer

eLife , 2017 Sep 11; 6:e27861. Epub 2017 Sep 11

PubMed ID: 28891793 DOI: 10.7554/eLife.27861

Michael J Waring, Huawei Chen, Alfred A Rabow, Graeme Walker, Romel Bobby, Scott Boiko, Rob H Bradbury, Rowena Callis, Edwin Clark, Ian Dale, Danette L Daniels, Austin Dulak, Liz Flavell, Geoff Holdgate, Thomas A Jowitt, Alexey Kikhney, Mark McAlister, Jacqui Méndez, Derek Ogg, Joe Patel, Philip Petteruti, Graeme R Robb, Matthew B Robers, Sakina Saif, Natalie Stratton, Dmitri I Svergun, Wenxian Wang, David Whittaker, David M Wilson, Yi Yao

Potent and selective bivalent inhibitors of BET bromodomains

Nature Chemical Biology , 12, 1097-1104 (2016)

DOI: 10.1038/nchembio.2210

Maili Zimmermann, Francisco Bianchetto Aguilera, Monica Castellucci, Marzia Rossato, Sara Costa, Claudio Lunardi, Renato Ostuni, Giampiero Girolomoni, Gioacchino Natoli, Flavia Bazzoni, Nicola Tamassia, Marco A. Cassatella

Chromatin remodelling and autocrine TNF╬▒ are required for optimal interleukin-6 expression in activated human neutrophils

Nature Communications , 6, (2015)

PubMed ID: 0 DOI: 10.1038/ncomms7061

Zuber J, Shi J, Wang E, Rappaport AR, Herrmann H, Sison EA, Magoon D, Qi J, Blatt K, Wunderlich M, Taylor MJ, Johns C, Chicas A, Mulloy JC, Kogan SC, Brown P, Valent P, Bradner JE, Lowe SW, Vakoc CR

RNAi screen identifies Brd4 as a therapeutic target in acute myeloid leukaemia

Nature , 2011 Aug 3; 478(7370):524-528. Epub 2011 Aug 3

PubMed ID: 21814200 DOI: 10.1038/nature10334

Li GQ, Guo WZ, Zhang Y, Seng JJ, Zhang HP, Ma XX, Zhang G, Li J, Yan B, Tang HW, Li SS, Wang LD, Zhang SJ

Suppression of BRD4 inhibits human hepatocellular carcinoma by repressing MYC and enhancing BIM expression

Oncotarget , 1/01/01; 7(3):2462-2474. Epub 2015 Nov 12

PubMed ID: 26575167 DOI: 10.18632/oncotarget.6275

Johnson GR, Li J, Shariff A, Rohde GK, Murphy RF

Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules

PLoS Comput Biol , 1/01/01; 11(12):e1004614. Epub 2015 Dec 1

PubMed ID: 26624011 DOI: 10.1371/journal.pcbi.1004614

Did we miss your publication?

Have you published using HPA015055? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch