Anti-BLM Antibody

Bloom syndrome, RecQ helicase-like
Recommended Applications
Product Description
Polyclonal Antibody against Human BLM
Alternative Gene Names
BS, RECQ2, RECQL3
Price
$445.00
Product Number
HPA005689
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
Bloom syndrome, RecQ helicase-like
Target Gene
BLM
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000011213 (64%)

Mouse ENSMUSG00000030528 (64%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
Bloom syndrome, RecQ helicase-like
Gene Name
BLM
Alternative Gene Names
BS, RECQ2, RECQL3
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000197299 on the Human Protein Atlas

Croft LV, Ashton NW, Paquet N, Bolderson E, O’Byrne KJ, Richard DJ

hSSB1 associates with and promotes stability of the BLM helicase

BMC Mol Biol , 2017 May 15; 18:13. Epub 2017 May 15

PubMed ID: 28506294 DOI: 10.1186/s12867-017-0090-3

Pal D, Pertot A, Shirole NH, Yao Z, Anaparthy N, Garvin T, Cox H, Chang K, Rollins F, Kendall J, Edwards L, Singh VA, Stone GC, Schatz MC, Hicks J, Hannon GJ, Sordella R

TGF-β reduces DNA ds-break repair mechanisms to heighten genetic diversity and adaptability of CD44+/CD24− cancer cells

eLife , 2017 Jan 16; 6:e21615. Epub 2017 Jan 16

PubMed ID: 28092266 DOI: 10.7554/eLife.21615

Meena JK, Cerutti A, Beichler C, Morita Y, Bruhn C, Kumar M, Kraus JM, Speicher MR, Wang ZQ, Kestler HA, d’Adda di Fagagna F, Günes C, Rudolph KL

Telomerase abrogates aneuploidy-induced telomere replication stress, senescence and cell depletion

EMBO J , 2015 May 12; 34(10):1371-1384. Epub 2015 Mar 27

PubMed ID: 25820263 DOI: 10.15252/embj.201490070

Lao VV, Welcsh P, Luo Y, Carter KT, Dzieciatkowski S, Dintzis S, Meza J, Sarvetnick NE, Monnat RJ Jr, Loeb LA, Grady WM

Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers

Transl Oncol , 2013 Aug; 6(4):458-469. Epub 2013 Aug 1

PubMed ID: 23908689 DOI: 10.1593/tlo.13238

Did we miss your publication?

Have you published using HPA005689? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch